KEGG   Burkholderia thailandensis E264: BTH_II1637Help
Entry
BTH_II1637        CDS       T00311                                 

Definition
di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bte  Burkholderia thailandensis E264
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:1920321..1921898
Genome map
AA seq 525 aa AA seqDB search
MHHAGRRSGAARAGFFFCTITTERSSMAEPLAAQSAPPSRSDDSVRPPRSARVDASASTA
PPAAPPDSPHSPRRRARAARHVLKTAAFGALGFAAFALAFPEHAPNALGAIVEDLTGANP
HPVALRRPAAEPLSAVAQLGRALFFDPSLSASGRQSCASCHSPDRAYGPPNDLDVQLGGA
ALTRPGYRPPPSLMYLYRQPNFSIGPDSSENDDAASVAQQAASAAGVVRARKTAGAAAAP
QLVPQGGMFWDGRADTLQQQAFGPLMNPVEMANASTADVARKLENARYAPQFRQLFGPRI
FDDARLAVSEAMFAIARYQVEDPSFHPYSSKYDRWLEGDARLTRAELRGMRLFNDPAKAN
CAGCHLSKPSPDGLPPMFTDFQYEALGVPRNRALAQNRNPAFHDLGICGPLRDDLKTQTQ
YCGMFATPSLRNVATRHVFFHNGVYHSLDQVLAFYNLRSVDPGKIYPRDASGRVRQYDDI
PSAYRANVDVADAPFDRKPGDAPAMTAQDMRDIVAFLNTLTDEKR
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccacgccggccgtcgctccggcgcggcgcgcgccggatttttcttttgcacgatc
acgaccgaacgctccagcatggccgaaccgcttgccgcgcaatccgcaccgccctcacga
tccgacgattccgtccggcctccccgctcggcccgagtcgacgcatccgcgtcgacggcg
cctcccgccgcgccccctgattcgcctcattcgccccgccgccgcgcgcgcgcggcgcgc
cacgtgctgaagaccgccgcattcggcgcgctcggcttcgccgcattcgcgctcgcgttt
cccgagcacgcgccgaatgcgctcggcgcgatcgtcgaggatctgacgggcgcgaatccg
catccggtcgcgctgcgccgcccggccgccgagccgttgagcgcggtcgcgcagctcggc
cgggcgctgttcttcgatccgtcgctgtccgcgtcgggccgacagtcatgcgcgtcgtgc
cacagccccgaccgggcatacggcccgccgaacgatctcgacgtgcagttgggcggtgcc
gcgctgacgcggcccggctaccggccgccgccgtcgctgatgtatctgtaccgccagccg
aacttcagcatcggccccgactcgtcggagaacgacgatgcggcgagcgtcgcgcagcag
gcggcgtcggccgcgggcgtcgtgcgcgcgcggaagaccgccggcgcggccgccgcaccg
cagctcgtgccgcaaggcggaatgttctgggacggccgcgcggacacgctgcagcagcag
gcgttcggcccgctgatgaatccggtcgagatggcgaacgcgagcacggccgacgtcgcg
cgcaagctcgagaacgcgcggtacgcgccgcagttccggcagttgttcggcccgcgcatc
ttcgacgacgcgcgtcttgcggtgtccgaagcgatgttcgcgatcgcgcgctaccaggtc
gaggacccgtcgttccatccgtattcgagcaagtacgaccgctggctcgaaggcgacgcg
cggctcacgcgggccgagctgcgcggcatgcggctcttcaacgatccggcgaaggcgaat
tgcgcgggctgccatctgtcgaagccgagcccggacggcctgccgccgatgttcaccgat
ttccagtacgaagcgctcggcgtgccccgcaaccgcgcgctcgcgcagaaccgcaatccg
gcgttccacgatctcggcatttgcgggccgttgcgcgacgacctgaaaacgcagacgcaa
tactgcgggatgttcgcgacgccgtcgctgcgcaacgtcgcgacgcgtcacgtgttcttc
cacaacggcgtctatcactcgctcgatcaggtgctcgcgttctacaacctgcgcagcgtc
gatccgggcaagatctacccgcgcgacgcgagcggccgggtgcggcagtacgacgacatc
ccgagcgcgtatcgcgcgaacgtcgacgtcgccgacgcgccgttcgaccgcaagccgggc
gacgcgccggcgatgaccgcgcaggacatgcgcgacatcgtcgcgttcctgaacacgctg
accgacgagaagcgctga

DBGET integrated database retrieval system