KEGG   Burkholderia thailandensis E264: BTH_II1788Help
Entry
BTH_II1788        CDS       T00311                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bte  Burkholderia thailandensis E264
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bte00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bte00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:bte00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:2159271..2160311
Genome map
AA seq 346 aa AA seqDB search
MRHRIAERASMPEMQMRSLNADLLRYHRGPRSRVLGHASMTETNYQEILERIHCDIEPLR
TAGRVADYIPELASVPAERFGMAVVTLDGRVFSVGDARERFSIQSISKLFACTLAFQLLG
DSLWKRVGREPSGTAFNSLVQLESERGIPRNPFINAGALIVTDVLCRRFVGAETALVQFM
RRLTGVTDLDYNLRVANSELAHAERNRAMAHFMASFGNLHMPPETVIDAYCRQCAIEMNC
IELATAALFLANAGVAPVSGERILDASSAKRLSALMLTCGTYDAAGDFVYRVGLPAKSGV
GGGIVAVLPGEMAVCVWSPGLDANGNSVAGVHALEQLTTLTGQSIF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcgccaccgtatcgcggaaagagcctccatgccggaaatgcagatgcgcagcttgaac
gccgatctgctgcggtatcatcgcgggccgcgctcaagagttctcggacacgcatccatg
accgaaaccaactatcaggaaatcctcgaacgaattcattgcgacatcgagccgttacgc
acggcgggccgcgtcgccgactacatcccggagcttgccagcgtgcctgccgagcgcttc
ggcatggccgtcgtcaccctcgacggccgcgtgttctccgtcggcgatgcgcgcgaacgg
ttctcgatccagagcatctcgaaactctttgcgtgtaccctcgcctttcagttgcttggc
gactcgctttggaaacgggtaggccgagagccgtcgggaaccgcttttaactcgctcgtc
cagcttgagagcgagcgcggcataccgcgcaatccgttcatcaatgccggggcgctcatc
gtcaccgacgtcttgtgccgccggttcgtcggtgctgaaactgcgctcgtccagttcatg
cgacggctgaccggtgtcacagacctcgactataacctccgagtcgcgaattccgagctt
gcccacgccgaacgcaatcgcgcgatggcacacttcatggcgagctttggcaatctgcat
atgccgcccgagacggtcatcgacgcctattgccgccagtgcgcgatcgaaatgaactgc
atcgagctggcgaccgcggccctctttctcgccaatgccggcgttgcccccgtttccggc
gagcgcattctcgacgccagctcagccaaacgcctatccgccctcatgctgacgtgtggc
acatacgacgcggccggcgacttcgtatatcgcgtcggcctgcccgcgaaaagcggcgtg
ggcggcggtatcgtcgccgtgctaccgggcgagatggcggtgtgcgtctggtcgcccgga
ctcgacgcgaacggcaactccgtcgccggcgttcacgcgctcgaacagctgaccacgctt
accggccagtcgattttttga

DBGET integrated database retrieval system