KEGG   Burkholderia thailandensis E264: BTH_II1870Help
Entry
BTH_II1870        CDS       T00311                                 

Definition
glutathione-independent formaldehyde dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bte  Burkholderia thailandensis E264
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bte01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:bte00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:bte00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:complement(2265414..2266847)
Genome map
AA seq 477 aa AA seqDB search
MRVARIAAVADCAYGADGASARPFPSHVGRGQADVGFWTLAPLARGLPSEGSLQVRPMRV
RAGRATRGAPPTRHGDEAMSSNRGVVYQGPGKVEVQKIDYPKMVDPSGRAIGHGVILKVV
STNICGSDQHMVRGRTTAPVGLVLGHEITGEVVEVGRDVETLRIGDLVSVPFNVACGRCA
MCKEQHTGVCLNVNPSRAGGAYGYVDMGGWIGGQAEYVLVPYADFNLLKFPDRDRAMTKI
RDLTCLSDILPTGYHGAVTAGVKPGSTVYVAGAGPVGMAAAASARLLGAACTIVGDMNAE
RLAHAKAMGFEVVDLSKDATLGEQIEQILGKPEIDCAVDCVGFEAHGHGSSGHAEEAPAT
VLNSLMEITRPAGAIGIPGLYVTDDPGAADAAAKHGSLSIRFGLGWAKSHSFHTGQTPVL
KYSRNLMQAILFDRLPIAQIVNVTVISLDDAPEGYRKFDGGAPRKFVIDPHGMLKAA
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcgtcgcgcggatcgccgctgtcgccgattgtgcctatggtgccgatggcgcgtcg
gcgcggccgtttccatcgcatgtcggtcgcggccaagccgatgtcggtttttggacgctc
gcccccctggctcgcggactaccctcggaaggctcgctgcaagtcaggccgatgcgcgta
cgcgcgggccgggcgacgcgcggcgcaccgccaacgagacatggagacgaagcgatgagc
agcaaccgaggtgtcgtgtatcaggggccgggcaaggtcgaggtgcagaagatcgactat
ccgaagatggttgatccgagcggccgcgcgatcggccacggcgtgatcctgaaggtcgtc
agcacgaatatctgcggctccgatcagcacatggtgcgcggccgcacgacggcgcctgtc
ggtctcgtgctcggccacgagattacgggcgaggtggtcgaggtgggccgcgacgtcgag
acgctgaggatcggcgatctggtgtcggtgccgttcaacgtcgcgtgcggccgctgcgcg
atgtgcaaggagcagcacacgggcgtgtgcctgaacgtgaatccgtcgcgcgcgggcggc
gcgtacggctacgtcgacatgggcggctggatcggcggtcaggccgaatacgtgctcgtg
ccgtacgccgacttcaacctgctgaaattccccgatcgcgatcgggccatgacgaagatc
cgcgatctcacgtgtctgtcggacatcttgccgaccggctatcacggcgcggtcacggcc
ggcgtgaagcccggctcgacggtctacgtcgcgggcgcgggcccggtcgggatggcggcc
gccgcgtcggcgcgcctgctcggcgccgcgtgcacgatcgtcggcgacatgaacgccgaa
cgtctcgcgcacgcgaaggcgatgggcttcgaagttgtcgatctgtcgaaggacgcgacg
ctcggcgagcagatcgagcagattctgggcaagccggagatcgattgcgcagtcgactgc
gtcggcttcgaggcgcacgggcacggttcgtccggtcacgcggaggaggcgcccgcaacg
gtgctgaactcgctgatggagatcacgcggcccgcgggcgcgatcggcattcccggcctg
tacgtgaccgacgatccgggcgccgccgacgccgccgcgaagcacggcagcctgagcatc
cgcttcggcctcggttgggcgaagtcgcactcgttccataccggccagacgcccgtgctc
aagtacagccgcaatctgatgcaagcgatcctgttcgaccggctgccgatcgcgcagatc
gtcaacgtgacggtgatttcgctcgacgatgcgccggaaggctacaggaagttcgacggc
ggcgcgccgcgcaaattcgtcatcgatccgcacgggatgctgaaggcggcctga

DBGET integrated database retrieval system