KEGG   Burkholderia thailandensis E264: BTH_II2038Help
Entry
BTH_II2038        CDS       T00311                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bte  Burkholderia thailandensis E264
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bte00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:bte00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:complement(2485665..2486453)
Genome map
AA seq 262 aa AA seqDB search
MTSNLNGKAAVVTGAASGIGKEIALELARAGAAVAIADLNQDGANAVAEQIKQAGGKAIG
VAMDVTNEDAVNAGVDKVAETFGSVDILVSNAGIQIVNPIENYAFADWKKMQAIHVDGAF
LTTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHGLLGLARVLAKEGAKHNV
RSHVVCPGFVRTPLVDKQIPEQAKELGISEEEVVKKVMLGQTVDGVFTTVEDVAKTVLFL
SAFPSAALTGQSFVVSHGWFMQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgaacttgaacgggaaagcggcggtcgtgacgggcgcagcaagcggcatcggc
aaggaaatcgcgctggagcttgcgcgggcgggcgcggcggtcgcgatcgcggatctgaat
caggacggcgcgaacgcggtggccgagcagatcaagcaggcggggggcaaggcgatcggc
gtcgcgatggacgtgacgaacgaggacgcggtgaacgccggcgtcgacaaggtcgcggag
acgttcggctcggtcgacattctcgtgtcgaatgcgggcattcagatcgtcaatccgatc
gagaactacgcgttcgcggactggaagaagatgcaggcgatccacgtcgacggcgcgttc
ctgacgacgaaggccgcgctcaagcacatgtacaaggacgatcgcggcggcgtcgtgatc
tacatgggctcggtgcattcgcacgaggcgtcgccgctgaagtcggcgtacgtgacggcc
aagcacgggctgctggggcttgcgcgcgtgctggcgaaggaaggcgcgaagcacaacgtg
cgctcgcacgtggtgtgtccaggcttcgtgcgcacgccgctcgtcgacaagcagattccg
gagcaggccaaggagctcgggatcagcgaagaggaggtggtgaagaaggtgatgctcggc
cagacggtggacggcgtgttcacgacggtcgaggacgtcgcgaagacggtgctgttcctg
tcggcgttcccgagcgcggctctcaccggccagtcgttcgtcgtcagccacggctggttc
atgcagtaa

DBGET integrated database retrieval system