KEGG   Burkholderia thailandensis E264: BTH_II2061Help
Entry
BTH_II2061        CDS       T00311                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
bte  Burkholderia thailandensis E264
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BTH_II2061 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BTH_II2061 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    BTH_II2061 (glcB)
Enzymes [BR:bte01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BTH_II2061 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
II:complement(2511998..2514172)
Genome map
AA seq 724 aa AA seqDB search
MIERHELRVDEGLARFIEHEAMPGTGVDAAAFWQGFAALVHDLAPRNRALLAERDRLQRE
LDGWHRAHPGPVSDPRGYRAFLERIGYLVPPPERVAAATENVDSEIASQAGPQLVVPLSN
ARYALNAANARWGSLYDALYGTDALPEDGGATRAGAYNPVRGQRVIDYARDFLDRAAPLL
HGSHRDALRYRVDEGRLVVDTRDGAKALARPGQFAGHQGDAGAPSAVLLKHHGLHIEIRI
DASTPIGQGDPAHVTDVVLEAAVSTIIDCEDSVAAVDADDKVQLYRNWLGLIQGTLSEVV
DKGGRTFTRRLNADRAYRAPDGSTLTLHGRSLLFVRNVGHLMTTNAVLDRDGNEIPEGML
DGVVTTLCAMHDLTSKRNSRTGSIYIVKPKMHGPAEVAFADALFARVEDLLGLPRHTIKM
GIMDEERRTSVNLSACIAAAAARVAFINTGFLDRTGDEMHSAMEAGPMYRKGDMKSSAWI
AAYERNNVLAGLAAGLRGRAQIGKGMWAMPDLMRAMLEQKIAHPRAGANTAWVPSPTAAT
LHALHYHEVDVQAIQQELETIDYARERDALLDGLLTIPVVERAGWSDDEIRAEVENNAQG
ILGYVVRWVEQGIGCSKVPDIHDVGLMEDRATLRISSQHIANWLHHGVVTRAFVDEVFAR
MARVVDAQNAGDPNYRPMAADPANSHAFGAARALVLEGREQPSGYTEPLLHRYRLAFKQR
LKAG
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaacgacatgaactccgggtcgacgaaggtctcgcccggttcatcgaacacgaa
gcgatgcccggcacgggcgtcgacgcggccgcgttctggcagggcttcgccgcgctggtg
cacgacctcgcgccgcgcaatcgcgcgctgctcgcggagcgcgaccggctgcagcgcgag
ctcgacggctggcaccgcgcgcatccggggccggtgagcgacccgcgcggctaccgggcg
ttcctcgagcggatcggctatctggtgccgccgcccgagcgcgtcgcggcggcgaccgag
aacgtcgacagcgagatcgcgtcgcaggcgggcccgcagctcgtcgtgccgctgtcgaac
gcgcgctatgcgctgaacgcggcgaatgcgcgctggggcagcctgtacgacgcgctgtac
ggcaccgacgcgctgcccgaagacggcggcgcgacgcgcgcgggcgcgtacaacccggtg
cgcggccagcgcgtgatcgactacgcgcgcgacttcctcgatcgcgcggcgccgctgctg
cacggctcgcatcgcgacgcgctgcgctatcgcgtcgacgaaggccggctcgtcgtcgac
acccgcgacggcgcgaaggcgctcgcgcgcccgggccagttcgccggccaccagggcgac
gcgggcgcgccgagcgccgtgctgctcaagcatcacgggctgcacatcgagattcggatc
gacgcgtcgacgccgatcggtcaaggcgatcccgcgcacgtgaccgacgtcgtgctcgaa
gcggcggtgagcacgatcatcgattgcgaggattcggtcgcggccgtcgacgcggacgac
aaggtccagctctaccgcaactggctcggcctgattcagggcacgctgagcgaagtggtg
gacaagggcgggcgcacgttcacgcgccggcttaacgcggaccgcgcgtatcgcgcgccc
gacggctcgacgctcacgctgcacggccgctcgctgctgttcgtgcgcaacgtcggccat
ctgatgacgacgaacgcggtgctcgatcgcgacggcaacgaaattcccgaaggcatgctc
gacggcgtcgtcacgacgctttgcgcgatgcacgatctgacgtcgaagcgcaattcgcgc
acgggctcgatctacatcgtgaagccgaagatgcacgggcccgccgaggttgcgttcgcg
gatgcgctgtttgcgcgcgtcgaggatctgctcgggctgccgcgtcacacgatcaagatg
gggatcatggacgaggagcgccgcacgagcgtgaatctgtcggcgtgcatcgcggcggcg
gcggcgcgcgtcgcgttcatcaacacgggctttctcgaccgcacgggcgacgaaatgcac
agtgcgatggaagcggggccaatgtaccgcaagggcgacatgaagtcgtccgcgtggatc
gccgcgtacgagcgcaacaacgtgctcgcggggctcgcggccgggctgcgcggccgcgcg
cagatcggcaaggggatgtgggcgatgccggacctgatgcgcgcgatgctcgagcagaag
atcgcgcatccgcgcgcgggcgcgaacaccgcgtgggtgccgtcgccgaccgcggcgacg
ctgcatgcgctgcattaccacgaagtcgacgtgcaggcgatccagcaggaactcgaaacg
atcgactacgcgcgcgagcgcgatgcgctgctcgacggcctgctgacgattcccgtcgtc
gagcgcgccggctggagcgacgacgagattcgcgccgaagtcgagaacaacgcgcaaggc
atccttggctacgtcgtgcgctgggtcgagcagggcatcggctgctcgaaggtgccggac
attcacgacgtgggcctgatggaggatcgcgcgacgctgcgcatctcgagtcagcacatc
gcgaactggctgcaccacggcgtcgtcacgcgcgcgttcgtcgacgaggtgttcgcgcgg
atggcgcgcgtcgtcgatgcgcagaacgcgggcgacccgaactatcggccgatggcggcc
gatccggcgaactcgcacgctttcggcgcggcgcgcgcgctcgtgctggaaggccgcgag
cagccgagcggctataccgagccgctgctgcatcgataccggctcgcgttcaagcagcgc
ctgaaagcgggttga

DBGET integrated database retrieval system