KEGG   Burkholderia thailandensis E264: BTH_II2206Help
Entry
BTH_II2206        CDS       T00311                                 

Definition
(GenBank) acetyltransferase, GNAT family
Organism
bte  Burkholderia thailandensis E264
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
II:complement(2707737..2710247)
Genome map
AA seq 836 aa AA seqDB search
MMPMLAQLGDSAERHIGGARCFAYPMGTRARSGRAALRSPSLNPFSGVAVTVRNLDAMFH
PTSVAVVGASPRPGSVGAMVWACVLDGRFGGAIWPVNPKYGELNGHKAYPYVDQLPSAPS
VALVCTPPATWPGIVRKLGGLGARAAIIVGEARTSADRAALERALAAAKPYLLRVVGPGS
LGVVSPALNAHFGAPACIVKAGGVAWVSQSNALTNAVLGWAHARGLGFSHAVALGGEADV
DAADVLDYLASDASTRAILLELDTVKSARKFMSAARAAARNKPVLALRVGRGDSGDLLYT
AAFQRAGMVRVDALDDLLDEIETLGVGRAVAASGAATLVTSDRGVAKLAVDALAAAGETL
AQWPQAAVDEVGGALPAGIAAGNPLLLGDDARPEYFGAVLKALAQHPPTGTVFVVHATSH
SAPAGDVARVLIESRKFARRGMLACFFGGVDAATRDALHEHGIPVHTTPQRLARAHARLV
DYQLGRELLMQTPEGTPPQPVASISAAQHAARAALAQGRDGFEGEAALEWLAGFGIERST
DADVDGGDAIVDITVRMYDDQNFGPVFRYSVPPADGVSAPFVVYGLPPFNTVLARAVVAR
SPYARRAPPEPLLHALTALSQAVCEVREIVEMSLVLRVRPTRVVALEPRIRLATGRSRLA
IVPYPRYLEQKLDWHGERITVRPIRPEDEAAHRELLSAMTPDDLRMRFFGAVRNFDHSQI
ARMTQIDYDREMALIATRDDADGHAHTLGAVRAVTDPDNEATEFAIAVRPDQKGKGLGRM
LMTRIIEYARSRGTAWMIGEALRENTAMISLAKDSGFMVSSTEEPGVVAFRLKLQP
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
atgatgccgatgcttgcgcagctcggcgattcggccgaaaggcatataggcggcgcccga
tgcttcgcctatcctatgggcactcgggctcggtccggcagggccgcgcttcgatcgccg
tcgctcaatcctttcagcggagttgccgtgaccgttcgcaatctcgatgctatgttccat
ccgacgtccgttgccgtcgtcggcgcttcgccgcgtccgggcagcgtcggcgcgatggtt
tgggcgtgcgtgctcgacgggcggttcggcggtgcgatctggcccgtcaacccgaagtac
ggcgaactgaacggccacaaggcttacccatatgtcgaccagttgccgagcgcgccgtcg
gtcgcactcgtgtgcacgccgcccgcgacgtggcccggcatcgtgcgcaagctgggcggc
ctgggcgcgcgcgcggcgatcatcgtcggcgaagcccgcacgagcgctgatcgggccgcg
ctcgaacgggcgctcgccgcggcgaagccgtatctgctgcgcgtcgtcgggcccggcagc
ctgggtgtcgtatcgcccgcgctgaatgcgcatttcggtgcgccggcatgcatcgtcaag
gcgggcggcgtcgcgtgggtgtcgcaatcgaatgcgctgacgaacgcggtgcttggatgg
gcgcatgcgcgcgggctcggcttttctcatgcggtcgcgctcggcggcgaagcggacgtc
gacgcggccgacgtgctcgactacctcgcgagcgacgcctcgacgcgcgcgatcctgctc
gaactcgacacggtgaaatcggcgcgcaagttcatgtcggccgcacgcgcggcggcgcgc
aacaagccggtgctcgcgttgcgcgtggggcgcggtgattcgggcgatctgctctatacg
gccgcgtttcagcgtgctgggatggtgcgagtggacgcgctcgacgatctcctcgatgag
atcgagacgctcggcgtcggtcgggcagtggcggcgagcggtgcggcgacgctcgtgacg
agcgacagaggcgtcgcgaagcttgccgtcgatgcgctcgcggcggcgggggaaacgctc
gcgcaatggccgcaggcggctgtcgacgaggtcggcggcgcgctgcccgcgggaatcgcc
gcaggcaatccgctgctgctcggcgacgacgcgcgtcccgagtatttcggcgcggtgctg
aaggcgctcgcgcagcatcctccgacaggcaccgtgttcgtggttcatgcgacgtcgcat
agcgcgcccgcaggcgacgtcgcgcgcgtgctgatcgaatcgcgcaagttcgcgcgccgc
ggcatgctcgcgtgcttcttcggcggcgtcgatgccgcgacgcgcgacgcgctgcacgag
cacggcatccccgtgcacacgacgccacagcgtctcgcgcgcgcgcatgcgcgtctcgtc
gattatcaattgggccgagaactgttgatgcagacgccggagggcacgccgccgcaaccg
gtggcgtcgatctcggccgcgcagcacgcggcgcgcgcagcgctcgcacaggggcgtgac
gggttcgaaggcgaggcggcgctcgaatggctggccggcttcggcatcgagcgctcgacc
gacgcggacgtcgacggcggcgatgcgatcgtcgacatcacggtccggatgtacgacgac
cagaacttcgggccggtgttccgttattcggtgccgccagcggacggtgtttccgcgccg
ttcgtcgtctacgggctgccgcctttcaatacggtgctcgcgcgtgcagtcgtcgcgcgg
tcgccgtatgcgcgccgcgcgccgcccgagccgctgctgcacgcactgacggcgctttcg
caggcggtgtgcgaggtacgcgaaatcgtcgagatgtcgctcgtgctgcgcgtgcgtccc
acgcgcgtcgtcgcgctcgagcctcgcatcaggctcgcgacgggacgcagccggctcgcg
attgttccgtatccgcgctatctcgagcagaagctcgactggcacggggagcgcatcacc
gtgcggccgattcgccccgaggacgaggccgcgcatcgcgagctgctgagtgcgatgacg
ccggacgatttgcggatgcgtttcttcggtgcggtacgcaacttcgaccattcacagatc
gcgcgaatgacgcagatcgattacgaccgcgagatggcgctgatcgcgacgcgcgacgat
gccgacggccacgcgcatacgctgggcgcggtgcgggcggtaaccgatccggacaacgaa
gccaccgagtttgcgatcgcggtgcggcccgatcaaaagggcaagggacttgggcgaatg
ctgatgacgcgcatcatcgaatacgcgcgctcgcgcggaacggcgtggatgatcggcgag
gcgctgcgcgagaacacggcgatgatctcgctcgcgaaagacagcggctttatggtgtca
tcgaccgaagagccgggggtggtcgcgttccggttgaagctgcagccgtga

DBGET integrated database retrieval system