KEGG   Burkholderia thailandensis E264: BTH_II2206Help
Entry
BTH_II2206        CDS       T00311                                 

Definition
acetyltransferase
Orthology
K01905  
acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13]
Organism
bte  Burkholderia thailandensis E264
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bte00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bte00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bte00640]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:complement(2707737..2710247)
Genome map
AA seq 836 aa AA seqDB search
MMPMLAQLGDSAERHIGGARCFAYPMGTRARSGRAALRSPSLNPFSGVAVTVRNLDAMFH
PTSVAVVGASPRPGSVGAMVWACVLDGRFGGAIWPVNPKYGELNGHKAYPYVDQLPSAPS
VALVCTPPATWPGIVRKLGGLGARAAIIVGEARTSADRAALERALAAAKPYLLRVVGPGS
LGVVSPALNAHFGAPACIVKAGGVAWVSQSNALTNAVLGWAHARGLGFSHAVALGGEADV
DAADVLDYLASDASTRAILLELDTVKSARKFMSAARAAARNKPVLALRVGRGDSGDLLYT
AAFQRAGMVRVDALDDLLDEIETLGVGRAVAASGAATLVTSDRGVAKLAVDALAAAGETL
AQWPQAAVDEVGGALPAGIAAGNPLLLGDDARPEYFGAVLKALAQHPPTGTVFVVHATSH
SAPAGDVARVLIESRKFARRGMLACFFGGVDAATRDALHEHGIPVHTTPQRLARAHARLV
DYQLGRELLMQTPEGTPPQPVASISAAQHAARAALAQGRDGFEGEAALEWLAGFGIERST
DADVDGGDAIVDITVRMYDDQNFGPVFRYSVPPADGVSAPFVVYGLPPFNTVLARAVVAR
SPYARRAPPEPLLHALTALSQAVCEVREIVEMSLVLRVRPTRVVALEPRIRLATGRSRLA
IVPYPRYLEQKLDWHGERITVRPIRPEDEAAHRELLSAMTPDDLRMRFFGAVRNFDHSQI
ARMTQIDYDREMALIATRDDADGHAHTLGAVRAVTDPDNEATEFAIAVRPDQKGKGLGRM
LMTRIIEYARSRGTAWMIGEALRENTAMISLAKDSGFMVSSTEEPGVVAFRLKLQP
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
atgatgccgatgcttgcgcagctcggcgattcggccgaaaggcatataggcggcgcccga
tgcttcgcctatcctatgggcactcgggctcggtccggcagggccgcgcttcgatcgccg
tcgctcaatcctttcagcggagttgccgtgaccgttcgcaatctcgatgctatgttccat
ccgacgtccgttgccgtcgtcggcgcttcgccgcgtccgggcagcgtcggcgcgatggtt
tgggcgtgcgtgctcgacgggcggttcggcggtgcgatctggcccgtcaacccgaagtac
ggcgaactgaacggccacaaggcttacccatatgtcgaccagttgccgagcgcgccgtcg
gtcgcactcgtgtgcacgccgcccgcgacgtggcccggcatcgtgcgcaagctgggcggc
ctgggcgcgcgcgcggcgatcatcgtcggcgaagcccgcacgagcgctgatcgggccgcg
ctcgaacgggcgctcgccgcggcgaagccgtatctgctgcgcgtcgtcgggcccggcagc
ctgggtgtcgtatcgcccgcgctgaatgcgcatttcggtgcgccggcatgcatcgtcaag
gcgggcggcgtcgcgtgggtgtcgcaatcgaatgcgctgacgaacgcggtgcttggatgg
gcgcatgcgcgcgggctcggcttttctcatgcggtcgcgctcggcggcgaagcggacgtc
gacgcggccgacgtgctcgactacctcgcgagcgacgcctcgacgcgcgcgatcctgctc
gaactcgacacggtgaaatcggcgcgcaagttcatgtcggccgcacgcgcggcggcgcgc
aacaagccggtgctcgcgttgcgcgtggggcgcggtgattcgggcgatctgctctatacg
gccgcgtttcagcgtgctgggatggtgcgagtggacgcgctcgacgatctcctcgatgag
atcgagacgctcggcgtcggtcgggcagtggcggcgagcggtgcggcgacgctcgtgacg
agcgacagaggcgtcgcgaagcttgccgtcgatgcgctcgcggcggcgggggaaacgctc
gcgcaatggccgcaggcggctgtcgacgaggtcggcggcgcgctgcccgcgggaatcgcc
gcaggcaatccgctgctgctcggcgacgacgcgcgtcccgagtatttcggcgcggtgctg
aaggcgctcgcgcagcatcctccgacaggcaccgtgttcgtggttcatgcgacgtcgcat
agcgcgcccgcaggcgacgtcgcgcgcgtgctgatcgaatcgcgcaagttcgcgcgccgc
ggcatgctcgcgtgcttcttcggcggcgtcgatgccgcgacgcgcgacgcgctgcacgag
cacggcatccccgtgcacacgacgccacagcgtctcgcgcgcgcgcatgcgcgtctcgtc
gattatcaattgggccgagaactgttgatgcagacgccggagggcacgccgccgcaaccg
gtggcgtcgatctcggccgcgcagcacgcggcgcgcgcagcgctcgcacaggggcgtgac
gggttcgaaggcgaggcggcgctcgaatggctggccggcttcggcatcgagcgctcgacc
gacgcggacgtcgacggcggcgatgcgatcgtcgacatcacggtccggatgtacgacgac
cagaacttcgggccggtgttccgttattcggtgccgccagcggacggtgtttccgcgccg
ttcgtcgtctacgggctgccgcctttcaatacggtgctcgcgcgtgcagtcgtcgcgcgg
tcgccgtatgcgcgccgcgcgccgcccgagccgctgctgcacgcactgacggcgctttcg
caggcggtgtgcgaggtacgcgaaatcgtcgagatgtcgctcgtgctgcgcgtgcgtccc
acgcgcgtcgtcgcgctcgagcctcgcatcaggctcgcgacgggacgcagccggctcgcg
attgttccgtatccgcgctatctcgagcagaagctcgactggcacggggagcgcatcacc
gtgcggccgattcgccccgaggacgaggccgcgcatcgcgagctgctgagtgcgatgacg
ccggacgatttgcggatgcgtttcttcggtgcggtacgcaacttcgaccattcacagatc
gcgcgaatgacgcagatcgattacgaccgcgagatggcgctgatcgcgacgcgcgacgat
gccgacggccacgcgcatacgctgggcgcggtgcgggcggtaaccgatccggacaacgaa
gccaccgagtttgcgatcgcggtgcggcccgatcaaaagggcaagggacttgggcgaatg
ctgatgacgcgcatcatcgaatacgcgcgctcgcgcggaacggcgtggatgatcggcgag
gcgctgcgcgagaacacggcgatgatctcgctcgcgaaagacagcggctttatggtgtca
tcgaccgaagagccgggggtggtcgcgttccggttgaagctgcagccgtga

DBGET integrated database retrieval system