KEGG   Burkholderia thailandensis E264: BTH_II2206Help
Entry
BTH_II2206        CDS       T00311                                 

Definition
acetyltransferase
Orthology
K01905  
acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13]
Organism
bte  Burkholderia thailandensis E264
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTH_II2206
   00620 Pyruvate metabolism
    BTH_II2206
   00640 Propanoate metabolism
    BTH_II2206
Enzymes [BR:bte01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     BTH_II2206
Lipid biosynthesis proteins [BR:bte01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BTH_II2206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(2707737..2710247)
Genome map
AA seq 836 aa AA seqDB search
MMPMLAQLGDSAERHIGGARCFAYPMGTRARSGRAALRSPSLNPFSGVAVTVRNLDAMFH
PTSVAVVGASPRPGSVGAMVWACVLDGRFGGAIWPVNPKYGELNGHKAYPYVDQLPSAPS
VALVCTPPATWPGIVRKLGGLGARAAIIVGEARTSADRAALERALAAAKPYLLRVVGPGS
LGVVSPALNAHFGAPACIVKAGGVAWVSQSNALTNAVLGWAHARGLGFSHAVALGGEADV
DAADVLDYLASDASTRAILLELDTVKSARKFMSAARAAARNKPVLALRVGRGDSGDLLYT
AAFQRAGMVRVDALDDLLDEIETLGVGRAVAASGAATLVTSDRGVAKLAVDALAAAGETL
AQWPQAAVDEVGGALPAGIAAGNPLLLGDDARPEYFGAVLKALAQHPPTGTVFVVHATSH
SAPAGDVARVLIESRKFARRGMLACFFGGVDAATRDALHEHGIPVHTTPQRLARAHARLV
DYQLGRELLMQTPEGTPPQPVASISAAQHAARAALAQGRDGFEGEAALEWLAGFGIERST
DADVDGGDAIVDITVRMYDDQNFGPVFRYSVPPADGVSAPFVVYGLPPFNTVLARAVVAR
SPYARRAPPEPLLHALTALSQAVCEVREIVEMSLVLRVRPTRVVALEPRIRLATGRSRLA
IVPYPRYLEQKLDWHGERITVRPIRPEDEAAHRELLSAMTPDDLRMRFFGAVRNFDHSQI
ARMTQIDYDREMALIATRDDADGHAHTLGAVRAVTDPDNEATEFAIAVRPDQKGKGLGRM
LMTRIIEYARSRGTAWMIGEALRENTAMISLAKDSGFMVSSTEEPGVVAFRLKLQP
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
atgatgccgatgcttgcgcagctcggcgattcggccgaaaggcatataggcggcgcccga
tgcttcgcctatcctatgggcactcgggctcggtccggcagggccgcgcttcgatcgccg
tcgctcaatcctttcagcggagttgccgtgaccgttcgcaatctcgatgctatgttccat
ccgacgtccgttgccgtcgtcggcgcttcgccgcgtccgggcagcgtcggcgcgatggtt
tgggcgtgcgtgctcgacgggcggttcggcggtgcgatctggcccgtcaacccgaagtac
ggcgaactgaacggccacaaggcttacccatatgtcgaccagttgccgagcgcgccgtcg
gtcgcactcgtgtgcacgccgcccgcgacgtggcccggcatcgtgcgcaagctgggcggc
ctgggcgcgcgcgcggcgatcatcgtcggcgaagcccgcacgagcgctgatcgggccgcg
ctcgaacgggcgctcgccgcggcgaagccgtatctgctgcgcgtcgtcgggcccggcagc
ctgggtgtcgtatcgcccgcgctgaatgcgcatttcggtgcgccggcatgcatcgtcaag
gcgggcggcgtcgcgtgggtgtcgcaatcgaatgcgctgacgaacgcggtgcttggatgg
gcgcatgcgcgcgggctcggcttttctcatgcggtcgcgctcggcggcgaagcggacgtc
gacgcggccgacgtgctcgactacctcgcgagcgacgcctcgacgcgcgcgatcctgctc
gaactcgacacggtgaaatcggcgcgcaagttcatgtcggccgcacgcgcggcggcgcgc
aacaagccggtgctcgcgttgcgcgtggggcgcggtgattcgggcgatctgctctatacg
gccgcgtttcagcgtgctgggatggtgcgagtggacgcgctcgacgatctcctcgatgag
atcgagacgctcggcgtcggtcgggcagtggcggcgagcggtgcggcgacgctcgtgacg
agcgacagaggcgtcgcgaagcttgccgtcgatgcgctcgcggcggcgggggaaacgctc
gcgcaatggccgcaggcggctgtcgacgaggtcggcggcgcgctgcccgcgggaatcgcc
gcaggcaatccgctgctgctcggcgacgacgcgcgtcccgagtatttcggcgcggtgctg
aaggcgctcgcgcagcatcctccgacaggcaccgtgttcgtggttcatgcgacgtcgcat
agcgcgcccgcaggcgacgtcgcgcgcgtgctgatcgaatcgcgcaagttcgcgcgccgc
ggcatgctcgcgtgcttcttcggcggcgtcgatgccgcgacgcgcgacgcgctgcacgag
cacggcatccccgtgcacacgacgccacagcgtctcgcgcgcgcgcatgcgcgtctcgtc
gattatcaattgggccgagaactgttgatgcagacgccggagggcacgccgccgcaaccg
gtggcgtcgatctcggccgcgcagcacgcggcgcgcgcagcgctcgcacaggggcgtgac
gggttcgaaggcgaggcggcgctcgaatggctggccggcttcggcatcgagcgctcgacc
gacgcggacgtcgacggcggcgatgcgatcgtcgacatcacggtccggatgtacgacgac
cagaacttcgggccggtgttccgttattcggtgccgccagcggacggtgtttccgcgccg
ttcgtcgtctacgggctgccgcctttcaatacggtgctcgcgcgtgcagtcgtcgcgcgg
tcgccgtatgcgcgccgcgcgccgcccgagccgctgctgcacgcactgacggcgctttcg
caggcggtgtgcgaggtacgcgaaatcgtcgagatgtcgctcgtgctgcgcgtgcgtccc
acgcgcgtcgtcgcgctcgagcctcgcatcaggctcgcgacgggacgcagccggctcgcg
attgttccgtatccgcgctatctcgagcagaagctcgactggcacggggagcgcatcacc
gtgcggccgattcgccccgaggacgaggccgcgcatcgcgagctgctgagtgcgatgacg
ccggacgatttgcggatgcgtttcttcggtgcggtacgcaacttcgaccattcacagatc
gcgcgaatgacgcagatcgattacgaccgcgagatggcgctgatcgcgacgcgcgacgat
gccgacggccacgcgcatacgctgggcgcggtgcgggcggtaaccgatccggacaacgaa
gccaccgagtttgcgatcgcggtgcggcccgatcaaaagggcaagggacttgggcgaatg
ctgatgacgcgcatcatcgaatacgcgcgctcgcgcggaacggcgtggatgatcggcgag
gcgctgcgcgagaacacggcgatgatctcgctcgcgaaagacagcggctttatggtgtca
tcgaccgaagagccgggggtggtcgcgttccggttgaagctgcagccgtga

DBGET integrated database retrieval system