KEGG   Burkholderia thailandensis E264: BTH_II2241Help
Entry
BTH_II2241        CDS       T00311                                 

Definition
dihydroflavonol-4-reductase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
bte  Burkholderia thailandensis E264
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:2751285..2752301
Genome map
AA seq 338 aa AA seqDB search
MRTMTDIQRDLVLVTGASGFVGSAVARAARQQGHRVRVLVRPTSPRTNVADLDAEIATGD
MRDEASMRAALRGVRYLLHVAADYRLWAPDPLEIERANLEGAVATMRAALAEGVERIVYT
SSVATLKVTPSGASADESSPLTAEQAIGVYKRSKVLAERAVERMIADDRLPAVIVNPSTP
IGPRDVKPTPTGRIIVEAALGKIPAFVDTGLNLVHVDDVALGHLLALEHGRIGERYILGG
ENLPLQSMLADIAQLTGRKPPTIALPRWPLYPIALGAEAVAKLTKREPFVTVDGLKMSKN
KMYFTSAKAERELGYRARPYREGIRDALDWFRQAGYLR
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaggaccatgactgacatacaacgcgatctcgttctggtgaccggcgcatccggtttt
gtcggctccgccgtcgcgcgcgccgcgcggcagcaaggccatcgggtgcgcgtgctcgtg
cggccgacgagcccgcgcacgaacgtcgcggatctcgacgccgagatcgcgacgggcgac
atgcgcgacgaggcatcgatgcgcgccgcgctgcgcggcgtgcgctacctgctgcacgtc
gcggccgactaccggctatgggcgcccgatccgctcgagatcgagcgcgcgaacctcgag
ggcgcggtcgcgacgatgcgcgcggcgctcgccgagggcgtcgagcggatcgtctacacg
agcagcgtcgcgacgctgaaggtcacgccgtccggcgcctcggccgacgaatcgtcgccg
ctcacggccgagcaggcgatcggcgtgtacaagcgcagcaaggtgctcgccgagcgcgcg
gtcgaacggatgatcgccgacgacaggctgcccgcggtgatcgtcaacccgtcgacgccg
atcggcccgcgcgacgtgaagccgacgccgaccggccggatcatcgtcgaagccgcactc
ggcaagattccggcgttcgtcgacacgggcctgaacctcgtgcacgtcgacgacgtcgcg
cttggccacctgctcgcgctcgagcacggacggatcggcgagcgctacatcctcggcggc
gagaacctgccgctgcagtcgatgctcgcggacatcgcgcaattgacgggccgcaagccg
ccgacgatcgcgctgccgcgctggccgctgtacccgatcgcgctcggcgcggaggcggtc
gcgaagctgacgaagcgtgagccgttcgtgacggtcgacgggctcaagatgtcgaagaac
aagatgtacttcacgtcggcgaaggccgagcgcgaactcggctatcgcgcgcggccgtac
cgcgaaggcattcgcgacgcgctcgactggttccggcaggcgggatacctgcgctga

DBGET integrated database retrieval system