KEGG   Burkholderia thailandensis E264: BTH_II2309Help
Entry
BTH_II2309        CDS       T00311                                 

Definition
(Fe-S)-binding protein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
bte  Burkholderia thailandensis E264
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    BTH_II2309
Enzymes [BR:bte01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     BTH_II2309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:2828407..2830497
Genome map
AA seq 696 aa AA seqDB search
MRREAVFSGSTWRPCIVRFRGRDPGSARRGRQARGAGPAHRFVGVRLNRRAKEREINALT
RTLRFELMLGATRSTLRGSRGNARPRAARARAAGAERICGDKQRKPRDAGMRVARRAPHR
AAAGKQGDEPSARRRVRTIKKVNRMKQQSYDYDYVVVGSGFGGSVAALRLSEKGYRVLVI
EQGRRWTPENLPESTWNLSRWQWRPALGLRGFFSMRFFKHVVVLHGNAVGGGSITYANTL
LVPPDKVWREGTWAGLEDWERVMPEHYATAKRMLGVVTNRRMDAADFRLKEMAKLIGVEK
SFYPTEVGVFFGGDADAPGTRYADPYFGGAGPERTSCIGCGGCMVGCRHGAKNTLDRNYL
YLAERLGAQVREQTKVVDVRPLDARDDGAAGYAVDAVSLAAGARGAKSRVTCRGVVFAAS
SLGTQDLLMRLKEKRSLPRLSDALGKRVRTNAESLIGVRFPKSRVDLSKGVAIGSGIYID
EHTHIEATRYPSGSDTMGLLTTVLTRGAPGGLRPLVWLGALAKLVLTRPLTAWRMIDPRG
FARETMIFLCMQTLEGHLTMRLKRRWFWPFSKQLATSGAKIPAYIPAANDFAQKAARALG
GVPMTSLTEILLNVPMTAHCMGGAAMARDARDGVCDGRGRVFGYRNMYICDGSVLGANLG
VNPSLTITALAEHAMNHVPAAGEQQWNSAGEERVAA
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgcgaagcagttttctcgggatcgacgtggcgcccgtgcatcgttcggttcagg
ggcagagaccctggatcagcgcggcgcggccggcaagcgcgcggcgccggccccgcgcat
cgcttcgtcggcgtccgtttgaatcgccgcgcaaaagagcgggaaatcaacgcgctaacg
cgcacgctgcgtttcgaattgatgctcggcgcaacgcgctcgacactacggggttcgcgc
gggaatgcgcggccccgagcggcgcgcgcgagagccgccggggcggagaggatatgcggc
gataagcagcgtaagccgcgagacgcggggatgcgcgtcgcacgccgtgcaccgcatcgc
gcggcagcgggaaaacagggagacgaaccgtccgcgcgccggcgggttcgaacaatcaaa
aaggtgaaccgaatgaagcagcagtcctacgattacgactacgtcgtggtcggctccggc
ttcggcggcagcgtcgcggcgctgcgtctgtccgagaaaggctatcgcgtgctcgtgatc
gagcagggccgtcgctggacgcccgagaacctgccggaaagcacgtggaatctgtcgcgc
tggcaatggcgccccgcgctcgggctgcgcggcttcttcagcatgcgctttttcaagcac
gtcgtcgtgctgcacggcaatgcggtcggcggcggctcgatcacgtatgcgaacacgctg
ctcgtgccgcccgacaaggtgtggcgcgaaggcacgtgggccggcctcgaggactgggag
cgcgtgatgcccgaacactacgccaccgcgaagcgcatgctcggcgtcgtcacgaaccgg
cggatggacgcggccgatttccgcttgaaggagatggcgaagctgatcggcgtggagaag
agcttttatccgaccgaggtcggcgtgttcttcggcggcgacgccgacgcgcccggcacc
cgctacgccgatccgtacttcggcggcgcgggccccgagcgcacgtcgtgcatcggctgc
ggcggctgcatggtcggctgccgccacggcgcgaagaacacgctcgaccgcaattacctg
tacctcgccgagcgcctcggcgcgcaggtgcgcgagcaaacgaaggtcgtcgacgtgcgc
ccgctggacgcgcgcgacgacggcgcggcgggctacgcggtcgacgcggtgtcgctcgcg
gccggcgcgcgcggcgcgaaaagccgcgtcacgtgccgcggggtcgtgttcgccgcatcg
tcgctcggcacgcaggatctgctgatgcgtctgaaggaaaagcgctcgctcccgcgtctg
tcggacgcgctcggcaagcgcgtgcgcacgaacgccgaatcgctgatcggcgtgcgcttt
ccgaaatcgcgcgtcgatctgtcgaagggcgtcgccatcggctcgggcatctacatcgac
gagcacacgcacatcgaggccacccgctatccgtcgggctccgacacgatgggactgctc
acgaccgtgctcacgcgcggcgcgccgggcggcctgcgtccgctcgtatggctcggcgcg
ctcgcgaagctcgtcctcacgcggccgctgaccgcatggcggatgatcgatccgcgcggc
ttcgcgcgcgagacgatgatcttcctctgcatgcagacgctcgaaggacacctgacgatg
cggctgaagcgccgctggttctggccgttctcgaagcagctcgcgacgtccggcgcgaag
attcccgcctacatcccggccgcgaacgacttcgcgcaaaaggccgcgcgcgcgctcggc
ggcgtgccgatgacctcgctcaccgagatcctgctgaacgtgccgatgaccgcgcattgc
atgggcggcgcggcgatggcgcgcgacgcgcgcgacggcgtgtgcgacggccgcggccgc
gtgttcggctaccggaacatgtacatctgcgacggctcggtgctcggcgcgaatctcggc
gtcaacccgagtctcacgatcaccgcgctcgccgagcatgcgatgaaccacgtgcccgcg
gcgggcgagcagcagtggaacagcgccggggaggaacgcgtcgcggcatga

DBGET integrated database retrieval system