KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_00075Help
Entry
YBT020_00075      CDS       T01839                                 

Definition
deoxynucleoside kinase
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btf00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    YBT020_00075
   00240 Pyrimidine metabolism
    YBT020_00075
Enzymes [BR:btf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     YBT020_00075
    2.7.1.76  2'-deoxyadenosine kinase
     YBT020_00075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(22461..23129)
Genome map
AA seq 222 aa AA seqDB search
MNLRQKYDIPNDAVITIAGTVGVGKSTMTTALANALGYRTSFEKVDSNPYLDKFYADFTR
WSFHLQVYFLAERFKEQKRIFEYGGGFVQDRSIYEDTGIFAKMHHEKGTMTETDYETYKG
LFDAMVMTPYFPHPDLLIYLEGSFDDIVDRIQERGRPMEQQTPIEYWKEMHGRYENWINN
FNSCPVLRLNINEYDILKDGDSIEPIIKKIGHFLKQTRKLVK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaggcaaaaatatgatataccaaatgacgcagtaatcactatcgctggaaca
gtaggtgtcggtaaatccactatgacaactgcattggctaacgctttagggtatcgcaca
tcatttgaaaaggtagattctaatccgtatttggacaagttctatgctgatttcacacgc
tggagctttcacttacaagtgtattttttagcagaacgatttaaagaacaaaaaagaatt
tttgaatacggtggcggttttgttcaagatcgctctatctatgaagacactggcattttt
gcaaaaatgcatcacgaaaaaggtacaatgacagaaactgattatgaaacatataaaggt
ttatttgacgctatggtcatgactccttacttcccacatccagatttattaatttactta
gaaggttctttcgatgatattgttgatcgtatccaagaacgtggacgtccgatggaacag
cagacaccaatcgagtattggaaagagatgcatgggcgttatgaaaactggattaacaac
tttaattcatgccctgttttacgattaaacattaatgaatacgatattttaaaagatggc
gattccattgaaccaatcattaaaaaaatcggtcattttttaaaacaaacacgtaaactt
gtaaaataa

DBGET integrated database retrieval system