KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_00355Help
Entry
YBT020_00355      CDS       T01839                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:btf00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
78722..79237
Genome map
AA seq 171 aa AA seqDB search
MNNIAYIALGSNIGERYTYLTEAIQFLNKNPYIKVEDVSSVYETEPVGYTDQSCFLNLVI
KISTNLSPQELLKVTQKVENDLGRKREIRWGPRTIDLDILLYNQENIEAENLIVPHPRMF
ERAFVIVPLLEINQDIKQNISRSQVEEMKRREGVTVWKQKNGEDAFVLFEN
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaataatatagcttacattgcattaggttcaaatattggagagcgttatacgtattta
actgaagcgattcagtttctgaataaaaatccttatatcaaagttgaggatgtttcgtct
gtatatgagacggaaccggttggctatactgaccaaagttgctttttaaatttagttata
aaaatttctaccaatttatcaccgcaagaattattgaaagtaacgcaaaaagtagaaaat
gatctaggaagaaaaagggaaattaggtggggacctaggactatcgaccttgacatttta
ctatataatcaagaaaatattgaagcagagaatcttattgttccgcatccgcggatgttc
gaaagagcttttgttatcgttccgttgttagagattaatcaagatataaaacaaaacatt
tcacgttcacaagtagaagaaatgaaaaggcgagagggagtaacggtatggaagcagaaa
aatggggaagacgcattcgtgcttttcgaaaactaa

DBGET integrated database retrieval system