KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_00420Help
Entry
YBT020_00420      CDS       T01839                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:btf00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
103091..104548
Genome map
AA seq 485 aa AA seqDB search
MEKQVRVRYAPSPTGHLHIGNARTALFNYLFARHQDGKFIIRIEDTDVKRNVAGGEESQL
KYLKWLGMDWDEGVDVGGEFGPYRQTERLDIYKKLYEDLLERGLAYKCYMTEEELEAERE
GQIARGETPRYAGNHRDLTEAQVKEFEAEGRIPSIRFRVPADRDYTFKDIVKDEVAFHSN
DFGDFVIVKKDGIPTYNFAVAVDDHLMEITHVLRGDDHISNTPKQMMIYEAFGWDIPQFG
HMTLIVNESRKKLSKRDESIIQFIEQYKELGYLPEAIFNFIALLGWSPVGEEEIFSQEEF
IKMFDAARLSKSPALFDSQKLKWMNNQYMKKQDLDTVVELSLPHLVKAGRIGETLSEQEQ
AWIRDVIALYHEQMSFGAEIVELSEMFFKDHVDYEEEGQEVLKGEQVPDVLRAFAGQVEA
LEAMEPAAVKAAIKAVQKETGHKGKNLFMPIRVATTGQTHGPELPNAIALLGKEKVLNRL
QKVIG
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagcaagtgagagtgcgctatgcgccaagtccaacaggacacttacatatcgga
aatgcgcgtacggcattatttaattatttatttgctcgtcatcaagatggtaagtttatt
attcgtattgaagatactgatgtaaaacgtaatgttgctggtggagaagaaagccaatta
aaatacttgaaatggctcggtatggactgggatgaaggtgttgatgttggtggtgaattt
ggaccatatcgtcaaacagagcgtttagatatttataaaaagttatatgaagatttatta
gagcgtggtttagcttacaaatgttatatgacagaagaagagctagaagcagaacgcgaa
gggcaaatcgctcgtggtgaaacacctcgttatgcaggtaaccatcgtgatttaactgaa
gcgcaagtgaaagaatttgaagctgagggacgtattccaagtattcgtttccgtgtacca
gctgaccgtgattacacatttaaagatattgtaaaagatgaagttgcattccattcaaat
gatttcggtgatttcgttatcgtgaaaaaagatgggattccaacttataactttgcagta
gcagtagatgatcacttaatggaaattacacacgtacttcgtggtgatgaccatatttca
aacacgccaaaacaaatgatgatttatgaagctttcggttgggatattcctcaattcggt
catatgactttaattgtaaatgaaagccgtaaaaaattaagtaagcgtgatgaatctatt
attcaatttatcgagcaatataaagaacttggatatcttccagaagcaatctttaacttc
attgcactactaggttggtcgccagtaggagaagaagaaatcttctctcaagaagagttt
atcaaaatgttcgatgcagctcgtttatcaaaatcacctgcattatttgattctcaaaaa
ctgaaatggatgaacaaccaatatatgaaaaagcaagatttagatacggtggtagaatta
agcttaccgcatttagtgaaagctggacgtataggtgaaactttaagtgaacaagaacaa
gcttggattcgtgatgtaattgcgttatatcatgaacaaatgagctttggagctgaaatt
gtagagctttctgaaatgttcttcaaagatcatgttgattatgaagaagaaggacaagaa
gtattaaaaggtgaacaagtaccagacgtacttcgtgcatttgctggtcaagtagaagca
ctagaagctatggaaccggcagcagttaaggcggctattaaagcagttcaaaaggaaaca
ggtcataaaggtaaaaacctatttatgccaatccgtgttgcaactactggtcaaacacac
ggcccggagcttcctaatgctattgcacttcttggaaaagaaaaagttttaaatcgtctt
caaaaagtaattggttaa

DBGET integrated database retrieval system