KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_02210Help
Entry
YBT020_02210      CDS       T01839                                 

Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btf00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    YBT020_02210
Enzymes [BR:btf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     YBT020_02210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
459555..460196
Genome map
AA seq 213 aa AA seqDB search
MLLQKEREEIVAYGKKMISSGLTKGTGGNISIFNREQGLVAISPSGLDYYETKPEDVVIL
NLDGDVVEGERKPSSELDMHLIYYRKREDINALVHTHSPYAKTIASLGWELPAVSYLIAF
AGPNVRCAPYETFGTKQLAEAAFEGMIDRRAVLLANHGLIAGANNIKMAFTVAEEIEFCA
QIYYQTKSVGEPKLLPEDEMENLAKKFEGYGQQ
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgttattacaaaaagagagagaagaaattgtagcgtatggaaagaaaatgatttctagc
ggtttaacaaaggggacaggcggtaatattagtattttcaatcgggagcaaggccttgtt
gccattagcccaagtggtttagattattatgaaacgaagcctgaagatgtagttatatta
aacttagatggcgatgtagtagagggagagaggaaaccatcaagtgagctcgatatgcat
cttatttattatagaaagcgtgaagatataaatgcacttgtgcatacacattcaccttac
gcaaagacgattgcatcattaggatgggaacttcctgctgtatcatatttaattgctttc
gcgggaccgaatgtgcgctgtgcaccgtatgaaacatttgggacgaagcaattagcagag
gctgctttcgaagggatgattgatcgccgtgctgttttacttgcaaaccacggtttaatt
gcaggtgcaaataacataaaaatggcgtttactgttgcggaagaaattgagttttgtgca
caaatttattatcaaacgaaaagcgtcggagaaccgaagttattgccggaagatgagatg
gagaatttggcgaagaagtttgaaggatatgggcagcagtag

DBGET integrated database retrieval system