KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_04865Help
Entry
YBT020_04865      CDS       T01839                                 

Definition
hypothetical protein
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1026171..1026551
Genome map
AA seq 126 aa AA seqDB search
MKGNLSVQDLCTELEKEQLMELVVYLSNQYEGIDMDVMKWYTKQKRVGKKEVVFNKLLWD
YFDRAEEIICGLNTYGGGPEYLQDEVYGYLQNITELVVEYALPTKEKQVLMKQGDLVLFC
FLCKGG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaaggggaatttgtcggtacaagatttgtgtacggaattggaaaaagaacagttaatg
gaattagtcgtatacttgtcgaatcagtatgaaggcatagatatggatgtgatgaagtgg
tatacaaagcaaaagagggtcggaaagaaagaggttgtattcaataagctactatgggac
tactttgacagagcagaggaaataatatgcggccttaatacatatggtggtggtcctgaa
tatcttcaggatgaggtttatggatatttacagaacattacggagttggtagtggaatac
gctcttccaacaaaagaaaaacaagtattaatgaaacagggggacctggtgcttttttgt
tttctttgtaagggcgggtga

DBGET integrated database retrieval system