KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_06290Help
Entry
YBT020_06290      CDS       T01839                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
btf00630  Glyoxylate and dicarboxylate metabolism
btf01100  Metabolic pathways
btf01110  Biosynthesis of secondary metabolites
btf01120  Microbial metabolism in diverse environments
btf01200  Carbon metabolism
Module
btf_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:btf00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    YBT020_06290
Enzymes [BR:btf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     YBT020_06290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ADY20504
UniProt: F0PQ87
Position
1271469..1272746
Genome map
AA seq 425 aa AA seqDB search
MKNERIEKLQESWELDTRWKGITRPYSAEDVIRLRGSIDIEHTLARRGAEKLWASLHTED
YINALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLSGHMYPDQSLYPANSVPAVVKRI
NQTLQRADQIQHMEGSGDTDYFVPIVADAEAGFGGQLNVFELMKGMIEAGASGVHFEDQL
SSEKKCGHLGGKVLLPTQTAVRNLISARLAADVMGVPTIIVARTDADAADLITSDIDPVD
KAFITGERTPEGFYRTKAGLDQAIARGLAYAPYADLVWCETSEPNLEDAKRFADAIHKEH
PGKLLAYNCSPSFNWKQKLDEKTIASFQKEIASYGYKFQFVTLAGFHSLNYGMFELARGY
KERGMAAYSELQQAEFAAEKYGYSATRHQREVGTGYFDEVAQVITGGTSSTTALKGSTEE
AQFTK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgaaagaatcgagaaattacaagagagctgggagttagatacgcgctggaaa
gggatcacacgtccatattcggcagaagatgtaattcgcctgcgcgggtcaattgatatt
gaacatacgttagcgcgccgcggtgctgaaaagctgtgggcgtcgcttcatacggaagat
tacattaatgcacttggtgcattaacaggaaaccaagcgatgcaacaagtaaaagctggg
ttaaaagcaatttatttaagtggatggcaagtagcagcagatgcaaacctttctggacat
atgtatccagaccaaagtttatatccagcaaatagcgtacctgctgtagtaaaacgaatt
aatcaaacgcttcaacgtgcggatcaaattcagcatatggaaggaagcggtgatacagat
tatttcgtaccaattgtagcagatgcagaagctggatttggcggacaattaaacgtattt
gagctaatgaaaggtatgattgaagcaggcgcatctggtgtacactttgaagatcaatta
tcttcagagaagaaatgcggtcatttaggtggaaaagtattactaccaacgcaaacagcg
gtacgtaatttaatttcggcacgccttgctgcagacgtaatgggagtgccgacaattatt
gttgcaagaacagatgcggatgcagcagatttaattacgagcgatatcgatcctgttgat
aaagcgtttattacaggagaaagaacaccagaaggattttaccgtacgaaagcaggtctt
gatcaagcgattgcacgtggtttagcatacgctccttatgcagacctcgtttggtgtgaa
acatctgaaccaaatttagaagatgcaaaacgatttgcggacgcaattcataaagagcat
ccagggaaattgcttgcatacaattgttcaccttcatttaactggaaacaaaaactagat
gagaaaacaattgcgagcttccaaaaagaaatcgcatcttacggttataagttccagttt
gtaacacttgctggattccactcattaaactacggcatgttcgaattagcacgcggctat
aaagagcgcggcatggcagcgtactctgaactacaacaagcagaattcgcagcagaaaaa
tacggctactctgcaactcgccatcaacgagaagtaggaacaggttactttgatgaagta
gcacaggtgattacaggtggtacttcatcaacgacagcattaaaaggatctacggaagag
gcgcagtttacgaaataa

DBGET integrated database retrieval system