KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_07680Help
Entry
YBT020_07680      CDS       T01839                                 

Gene name
hisD
Definition
bifunctional histidinal dehydrogenase/histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:btf01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:btf00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1523576..1524865
Genome map
AA seq 429 aa AA seqDB search
MEIVFEDFQKALSKIKLLRENANIIEETVQRSVSEIVQNVRESRDDALSFYTKKFDGVKM
KEFRVSEEEIKRASMFVENSFLEALQEAKKNIISYHEKQKRQSMFDCASKGIIRGQIIRP
LENVGVYVPGGTASYPSSVLMNVLPAKLAGVKKIVMVTPPREGEIDPHILVAASLAGVDE
IYTIGGAQAIAALAYGTESIPKVDKIVGPGNLYVALAKREVYGIVNIDMIAGPSEIVVIA
DETGNAKYIAADLLSQAEHDERATAICITTNIDLAKEVEKEIERQLETLPRSEIARESIK
RNGAIFIVPSLDEALKLSNEIAPEHLELHIKEPMNALAYVKHAGSIFLGPYAPEPLGDYL
AGPNHVLPTSGTARFFSPLSVDDFVKKSSFLSYTEEALRDVQHHIVELANKEGLHAHARA
IQIRFEEEE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggagatcgtttttgaagattttcaaaaggctttatcgaaaataaaattactacgagaa
aatgccaatataatagaagaaactgttcaaagaagtgtaagtgaaatcgttcaaaatgta
agggagagtagggatgatgccttatctttttatacaaaaaagtttgatggtgtaaagatg
aaagagtttcgtgtaagtgaagaagaaataaaacgagcgagtatgtttgtagagaattca
tttttagaagcgttacaagaggcgaagaaaaacattatttcgtaccatgaaaagcaaaaa
agacaatccatgttcgattgcgcgagtaaaggtatcattagaggacaaatcattcggccg
ttagagaatgtaggagtatatgtgccaggcggaactgcttcgtatccttcgtcagtatta
atgaatgtattgccagcaaaactcgctggtgtgaaaaagattgtaatggtaacaccgcca
agagaaggagaaattgatccacatattttagttgctgcaagccttgcaggagtagatgaa
atttatacgataggtggtgcgcaagcaattgctgctttagcatacgggacggaatcgatt
ccgaaagtggataaaatagttggaccaggaaatttgtacgtcgctttagcgaaacgagaa
gtatatggaatagtaaatatcgatatgattgctggaccgtcagaaattgtagttattgca
gatgaaaccggcaatgcaaaatatattgctgctgatttattatcacaagcagaacatgac
gagagagcgacagcaatttgtattacaacaaatatagatttagcaaaagaagtagaaaaa
gagatagaaaggcagttagaaacattaccaagaagcgaaattgcacgtgaatcaataaag
agaaatggagccatttttatcgttccttctttagatgaggcgctaaagttatcgaatgaa
attgccccggaacatttagagttacatataaaagaaccgatgaatgctctagcttatgtg
aaacatgcaggatctatctttcttggaccatatgcaccagaaccgctcggggattattta
gcaggaccgaatcacgtgttaccgacaagtggaacggcaaggtttttctcaccgttatca
gtcgatgattttgtgaaaaaatcaagctttctgtcttatacggaggaagcattaagagat
gtccaacatcatattgtagagcttgccaataaagaagggttacatgcgcatgcgagagcg
attcaaataagatttgaggaggaagaataa

DBGET integrated database retrieval system