KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_08205Help
Entry
YBT020_08205      CDS       T01839                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:btf00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1619136..1619705
Genome map
AA seq 189 aa AA seqDB search
MAKVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPKEHLHKVFG
EDHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLARTVDTIARRPQLQ
ERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLENDAAARS
EILSFIKTK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagttaatttagaacaaattgaacatgcagtacgccttattttagaggcaatt
ggagatgatcctaatcgagagggagtacttgatacaccaaagcgtgttgcaaaaatgtac
gcagaagtgttctcaggtatgcatgaagatccgaaagaacatttacacaaagtgttcgga
gaagatcatgaggagcttgtactagtaaaagatataccgttttattcgatgtgtgagcat
catttagttccattctatggagttgctcacgttgcatatattccgcaaggcggaaaagtg
acagggttaagtaaattagctcgtactgtagatacaattgcacgtcgtccacaactgcaa
gaacgtattacatcaacagtagcgaactctattatggaagtactagagccgcatggtgta
atggtagtagtagaagcggaacatatgtgtatgacgatgcgcggtgtgaaaaagccaggt
gcaaaaacagtaacaacagcagtacgtggtgtgctagaaaatgatgctgcagcacgtagt
gaaattttatcttttattaaaacgaagtaa

DBGET integrated database retrieval system