KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_09185Help
Entry
YBT020_09185      CDS       T01839                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:btf00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1804731..1806554)
Genome map
AA seq 607 aa AA seqDB search
MCGITGWVNWNKDLSNEHVILEKMANSIQHRGPDAEGFWFSPRAAFAHRRLIVIDPEGGT
QPKTFRAGDYTYALTYNGEIYNFRELREQLQRCGHSFETHSDTEVLLHSYLEWKEDCVQH
LNGIFAFALWDDQKQQLFLARDHLGVKPLFYTERNDSIIFGSEIKALLAHPSVPAEIDTD
GINEIFGLGLFRTPGCGVFKHIQEVRAGHSITFTRDKKIVTKYWNLESKTHTDSIEDTSS
HILSILQDTVKRQLIADVPLVCMLSGGLDSSGITALAGKEFAAENKTLHTYSVDFVNSAK
DFELTFARTGLDAPWVKRVSEHVGTSHHDIIVNAEELANHLFVPLRAKDLPSAGEMETSL
YLLFCEMKKDATVALSGESADEVFGGYPWFHQEELLYVDKFPWLTNWKNTSPLLLNEVSN
QCNLENYIDTRFQEAILEVPTLEGESKKSAKQRQMFYLFLTRFLPFLLDRKDRMSMAVGF
EVRVPFCDYRLVEYLWNVPFNIKSIDNIEKGILRRALKPALPDDVRNRRKSAYPTSQDPH
YLQTIRHLSLDMCSNKNNPIFSLINHSTLLAIANQSNKEINNFEARSAMEYMLQVNEWLK
TYHIHIA
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattacaggttgggtaaattggaataaagatctttccaatgaacatgttatt
ttagaaaagatggcaaatagcattcagcatcgtggtcctgatgctgaaggattttggttt
tcacctcgcgcggcctttgcacaccggcgtttaattgtaattgatccagaaggcgggacg
cagccgaagacatttcgtgctggtgattatacgtatgctcttacttataatggagaaatt
tataattttcgtgagctgagggaacaacttcaaagatgcggtcattcatttgaaacgcat
tcagatacagaagtgttactacattcgtatttagaatggaaagaagactgcgtacaacat
ttaaacggcattttcgctttcgccttatgggatgatcagaagcaacaactgtttttagca
cgtgatcatttaggcgtaaaaccactcttttatacagaaagaaatgacagcattattttc
ggatctgaaattaaagcattattagctcatccatctgtccctgctgaaattgatacggat
ggcataaatgaaatatttggattagggttatttcgaactccaggatgtggcgtctttaaa
catattcaagaagtgcgtgctggacattctataacgtttacacgtgataaaaaaatagtt
acaaagtattggaatttagaaagtaagacccatacagattctatagaagatacatcatca
catattttatctattttacaagatacagtaaaaagacaattaattgccgatgttcctcta
gtctgcatgttatcaggaggattagattctagcgggattactgcactagcagggaaagaa
tttgctgctgaaaataaaacacttcatacgtattccgttgactttgtaaatagtgcaaaa
gatttcgagctgacatttgctcgcactggtttagacgctccttgggtaaaacgcgtttct
gaacatgtagggacatctcatcatgatattattgtgaatgctgaagaattagcaaatcac
ttattcgttcccctccgtgcaaaagatttaccgagtgctggtgaaatggaaacttcacta
tatttactattttgcgaaatgaaaaaagatgcgaccgtagctttatccggcgaatctgct
gatgaagtattcggtggatacccttggtttcatcaagaggaattactatatgtagataag
tttccgtggctaacaaattggaaaaatacatctcctcttctactaaatgaagtaagtaac
caatgtaatctagaaaactatattgatacacgattccaagaagcgatacttgaagtacct
actcttgaaggcgaaagtaaaaaatccgcgaaacaacgtcaaatgttttatttattttta
acgagatttcttccattcttacttgaccgtaaagaccgtatgagtatggctgtaggattt
gaagttcgtgtaccgttttgcgattatcgattagttgaatatttatggaacgttcctttc
aacataaaaagcattgataatattgaaaaaggcattttacgtagagcattaaagcctgct
ttacctgacgatgtacggaatagaagaaaaagtgcgtatccaacttcacaagacccacat
tatttacaaacaatccgtcatttatcactcgacatgtgtagtaataaaaacaatcctatt
ttctcacttattaatcattccacattacttgctattgccaatcaaagtaataaagaaatt
aacaatttcgaagcaagaagtgctatggagtatatgctacaagtaaatgaatggttaaaa
acgtatcacatccatattgcttaa

DBGET integrated database retrieval system