KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_10415Help
Entry
YBT020_10415      CDS       T01839                                 

Definition
6-phosphate glucose kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:btf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YBT020_10415
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YBT020_10415
   00052 Galactose metabolism
    YBT020_10415
   00500 Starch and sucrose metabolism
    YBT020_10415
   00520 Amino sugar and nucleotide sugar metabolism
    YBT020_10415
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    YBT020_10415
   00524 Butirosin and neomycin biosynthesis
    YBT020_10415
Enzymes [BR:btf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     YBT020_10415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2057723..2058619
Genome map
AA seq 298 aa AA seqDB search
MKKAVGIDIGGTKIAAGIISDTGELLERVEIKSDPSDREKMFGRVVEAVEQVLKKSSISI
ANIEGIGVGVPGKVDREKGIAVFQNNLPWRQFPISVRLQEQFRIQRITIDNDVYMAAYAE
WRAAHVKEDETFVYVTISTGISCSIIHKGSFFRGAGFAGELGLIPVLMKRGNERLEKIAA
GPGIQRIAERDLQVDTISTKAVFASYINGVPEYQPIINEVADCLAQGLYKISCLLDPHKM
VFGGSVIVKNPFLLELIKEKLKSYQLPEQQHLLEQMSISTLAQNNGVVGAGLRVFEGK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggcagtcggcattgatattgggggaacgaagattgcagcgggaatcatttcg
gatacaggcgaactgcttgaacgtgtggaaataaaaagtgatccttcagaccgagaaaaa
atgtttggtagagttgtagaagctgtggaacaagttctcaaaaaatcatcgatttccatc
gctaatatcgaggggattggcgttggggtaccaggaaaagtagatcgcgagaaaggaatt
gccgtttttcaaaataatttaccttggagacagtttcccatttcagttcgtttacaagag
caatttcgtattcagcggattacgattgacaatgatgtctatatggcagcttatgccgaa
tggagagcagcacatgtaaaagaggatgaaacctttgtgtatgtgactataagtacggga
atatcttgttctatcattcataaaggctcattttttaggggggcaggatttgctggagaa
ctcggtttaattcctgtcctcatgaagaggggcaatgaacgattagaaaaaattgctgct
gggcctgggattcagagaatagccgaaagggacttacaggtagatacgatttcaacaaag
gctgtttttgctagttatataaatggtgtaccagaatatcagcccatcattaatgaggta
gctgattgtttagcacaaggtctttataagatttcctgtttattagatccgcataaaatg
gtttttggcggaagtgttattgtgaaaaatccatttctactggagttgattaaagagaag
ttaaaaagttatcagcttcctgagcaacaacatcttttggagcagatgagtatcagtaca
ttggcacaaaataatggagttgttggtgcaggattacgagtatttgaaggaaagtaa

DBGET integrated database retrieval system