KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_10765Help
Entry
YBT020_10765      CDS       T01839                                 

Definition
(RefSeq) phosphoglycerate mutase family protein
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:btf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YBT020_10765
   01230 Biosynthesis of amino acids
    YBT020_10765
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YBT020_10765
  Energy metabolism
   00680 Methane metabolism
    YBT020_10765
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YBT020_10765
Enzymes [BR:btf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     YBT020_10765
Exosome [BR:btf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   YBT020_10765
  Exosomal proteins of melanoma cells
   YBT020_10765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2126754..2127344
Genome map
AA seq 196 aa AA seqDB search
MQILLIRHGESEADILNVHEGRADFELTKKGRKQVQRLVQKVKADFPPDFIWASTLKRAR
ETGETLAEGIGCPIQLEQELMEFNNGVQAGLSFEEAKKYPEPKFLHDRFENGESFIEFRM
RIEGIFSKIVIENTYNRIAIVAHGGVINSLLRAFFKMPISMDYYFKIGDTGISLIEIDGE
QKTVHFINDTNHLHGM
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatactactaatacgccacggagaatcagaagctgatattttaaacgtacatgaa
ggacgagctgattttgaattaacaaaaaaaggaagaaaacaagtgcaaagacttgtacag
aaagtgaaagcagattttccgccagatttcatttgggcaagtacattaaaacgtgctcgc
gaaactggtgaaacgttagcagaaggaattgggtgcccaattcaattagaacaggaatta
atggagtttaataatggagtgcaagcaggtctttcatttgaagaagctaagaaatatcca
gagccaaagtttcttcatgaccgatttgaaaacggggaatcatttattgaatttagaatg
agaatagaaggcatcttttctaaaatcgtaatagagaatacatataaccgaattgcaatt
gttgcacacggtggtgtaataaatagtctattacgtgcgtttttcaaaatgccaatttca
atggactattattttaaaataggagatacgggaataagcttaattgaaattgacggtgaa
caaaaaacggtacattttattaatgatacgaatcatttgcacgggatgtag

DBGET integrated database retrieval system