KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_10965Help
Entry
YBT020_10965      CDS       T01839                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:btf00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:btf00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2158218..2158700
Genome map
AA seq 160 aa AA seqDB search
MTVYDFSAKTITGEEKSLKDYEGKVLLIVNVASKCGFTPQYKGLQEVYDKYKEQGLEILG
FPCNQFGGQEPGTEADITSFCELNYGVNFPMFAKIDVKGDKAHPLYTYMTEQAPGLLGMK
AVKWNFTKFLIGKDGKVVGRFAPQTKPVDLEVEIEKVLGE
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacagtttatgatttttcagctaaaacaataacaggtgaagaaaaatcgttaaaagat
tacgagggaaaagtacttcttattgtaaatgtagctagtaaatgcgggtttacaccgcaa
tataaaggattacaagaagtatatgataaatataaagaacaagggctagaaatactcggt
ttcccatgtaaccaattcggaggacaagaaccaggtacagaagcagatattactagtttt
tgtgagttaaactacggtgtaaacttcccaatgtttgcaaagattgatgtgaaaggcgat
aaggctcatcctctgtatacatacatgacagaacaagcaccaggtttactcggtatgaaa
gcagtaaaatggaactttacaaaatttctaattggaaaagacggaaaagtagtagggcgt
tttgcaccgcaaacgaagccggtggatttagaggttgagattgagaaggtacttggcgaa
taa

DBGET integrated database retrieval system