KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_10965Help
Entry
YBT020_10965      CDS       T01839                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
btf00480  Glutathione metabolism
btf00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:btf00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    YBT020_10965
  Metabolism of other amino acids
   00480 Glutathione metabolism
    YBT020_10965
Enzymes [BR:btf01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     YBT020_10965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ADY21437
UniProt: F0PLL7
Position
2158218..2158700
Genome map
AA seq 160 aa AA seqDB search
MTVYDFSAKTITGEEKSLKDYEGKVLLIVNVASKCGFTPQYKGLQEVYDKYKEQGLEILG
FPCNQFGGQEPGTEADITSFCELNYGVNFPMFAKIDVKGDKAHPLYTYMTEQAPGLLGMK
AVKWNFTKFLIGKDGKVVGRFAPQTKPVDLEVEIEKVLGE
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacagtttatgatttttcagctaaaacaataacaggtgaagaaaaatcgttaaaagat
tacgagggaaaagtacttcttattgtaaatgtagctagtaaatgcgggtttacaccgcaa
tataaaggattacaagaagtatatgataaatataaagaacaagggctagaaatactcggt
ttcccatgtaaccaattcggaggacaagaaccaggtacagaagcagatattactagtttt
tgtgagttaaactacggtgtaaacttcccaatgtttgcaaagattgatgtgaaaggcgat
aaggctcatcctctgtatacatacatgacagaacaagcaccaggtttactcggtatgaaa
gcagtaaaatggaactttacaaaatttctaattggaaaagacggaaaagtagtagggcgt
tttgcaccgcaaacgaagccggtggatttagaggttgagattgagaaggtacttggcgaa
taa

DBGET integrated database retrieval system