KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_11465Help
Entry
YBT020_11465      CDS       T01839                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:btf00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:btf00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2266888..2267376
Genome map
AA seq 162 aa AA seqDB search
MIVSFMVAMDENRVIGRDNNLPWRLPSELQYVKKTTMGHSLIMGRKNYEAIGRPLPGRRN
IIVTRNEGYHVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHA
FEGDTFFPEMDMTNWKEIFVEKGLTDEKNPYTYYYHVYEKQQ
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgatagtttcatttatggtcgcaatggacgaaaatcgagtaattggtagagataataat
ttgccttggcgtttaccgagtgaattacaatatgtaaagaaaacaacgatgggtcattcg
cttattatgggaagaaaaaactatgaagcgattggtagaccactgcctggaagacgtaat
attattgtaactcgtaatgaagggtatcatgttgaaggctgtgaagtagcacattctgta
gaagaagtgtttgagctatgcaaaaatgaagaagagatttttatttttggcggagcgcaa
atttatgatctctttttaccttatgtagataagttatatataacaaaaatccatcatgca
tttgaaggagatacattctttccagaaatggatatgacaaattggaaagaaatttttgtt
gaaaaaggtttaacggatgaaaaaaatccgtatacgtactattatcatgtatatgaaaag
caacaataa

DBGET integrated database retrieval system