KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_11610Help
Entry
YBT020_11610      CDS       T01839                                 

Definition
ethanol-active dehydrogenase/acetaldehyde-active reductase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:btf00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    YBT020_11610
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YBT020_11610
  Lipid metabolism
   00071 Fatty acid degradation
    YBT020_11610
  Amino acid metabolism
   00350 Tyrosine metabolism
    YBT020_11610
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    YBT020_11610
   00626 Naphthalene degradation
    YBT020_11610
Enzymes [BR:btf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     YBT020_11610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2292633..2293670
Genome map
AA seq 345 aa AA seqDB search
MKAVVVNKNSKANIEIIEKELRPLHSGEALVDVEYCGVCHTDLHVANHDFGNTDGRILGH
EGIGIVTKIADDVTSLKVGDRVSIAWMFQSCGRCEYCVTGRETFCREVKNAGYSVDGGMA
EQCIVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKVSDIKPGQPIVIYGCGGLGNLAI
QYAKNVFGAKVIAVDINDDKLALAKEVGADMTINPISQGPADKIVQDEFGGAYAAVVTAV
SKVAFNSAVDAVRACGKVVAVGLPVETMDLNIPRLVLDGIEVVGSLVGTRKDLEEAFMFG
AEGKVVPVVQTCSLDKVQNVFEEMEQGRIQGRMVIDFKQYNCDCK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtagtagttaataaaaatagtaaagcaaacattgaaattattgaaaaagaa
ttacgtccgttacactcaggtgaagcgctagtagatgtagagtattgtggagtttgtcat
actgatttacacgttgcaaatcatgattttggaaatacagatggccgtattcttggtcat
gagggtataggtattgtgacgaaaatcgctgatgatgttacttcactaaaggtgggggac
cgtgtaagtattgcatggatgttccaatcttgtggacgttgtgaatattgcgtaacaggt
agggaaacattttgccgtgaagttaagaatgctggttattcagtagatggtggtatggct
gaacaatgtattgtgacagctgattatgcggtgaaagtaccagaaggattagatccagct
caagcatcatcaatcacatgtgcgggtgtaactacatataaagctataaaagtatcggat
attaaacctggccaacctatcgtaatctatggttgtggtggattaggtaacctagctatt
caatatgctaaaaacgtatttggtgcaaaggtaattgcagtagatattaatgacgataaa
ttagccttagcaaaagaggttggagctgatatgacaatcaatccaatttctcaaggtcct
gctgataagattgttcaagatgagtttggtggtgcttatgctgctgtagtaacagctgtt
tcaaaagtagcattcaactctgcagttgatgcagtacgtgcttgtggtaaagtcgttgca
gtaggtttaccagtagaaacgatggatttaaacattccgcgacttgtattagatggaatt
gaagtggttggctctctagtcggtactcgtaaggatctagaagaggcatttatgttcggt
gcagaaggaaaagtagtgcctgttgttcaaacttgttctctagataaagtacaaaatgta
ttcgaagaaatggaacaaggtagaattcaaggacgtatggtaatcgattttaaacagtat
aattgtgattgcaaataa

DBGET integrated database retrieval system