KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_12915Help
Entry
YBT020_12915      CDS       T01839                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:btf00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    YBT020_12915
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    YBT020_12915
Enzymes [BR:btf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     YBT020_12915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2548852..2549292
Genome map
AA seq 146 aa AA seqDB search
MKLKELANLLLIKETIGNMDVEITGLEMDSRKITDGDLFICVSGIDGFLEDRHQFVEDAV
KNGAVALIVERDVNIEIPKIIVKDARYAMAVIASHFYGYPSNKMKLIGITGTNGKTTTSY
LLEKILSDYGYHTGLMGNNGVKVDSK
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactaaaagagctggcgaatttgttattgattaaagaaactattggcaatatggat
gtagaaattacagggttagaaatggattctagaaagataactgatggagatctatttata
tgtgtatcaggtatcgatggttttcttgaagatcgacatcaatttgttgaagatgcagtg
aagaatggtgctgtagcgttaattgtagaaagggatgtaaatattgagatacctaaaata
attgttaaagatgctaggtatgctatggcagttattgcgtcacacttctatggttatcca
tctaataaaatgaagctaattggaattacaggtacaaatggaaaaacaactacttcctat
ttacttgaaaaaattttaagtgattatggatatcatacggggctcatggggaataacgga
gtgaaagttgattcaaaatga

DBGET integrated database retrieval system