KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_13845Help
Entry
YBT020_13845      CDS       T01839                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
btf00010  Glycolysis / Gluconeogenesis
btf00020  Citrate cycle (TCA cycle)
btf00620  Pyruvate metabolism
btf01100  Metabolic pathways
btf01110  Biosynthesis of secondary metabolites
btf01120  Microbial metabolism in diverse environments
btf01130  Biosynthesis of antibiotics
btf01200  Carbon metabolism
Module
btf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:btf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YBT020_13845
   00020 Citrate cycle (TCA cycle)
    YBT020_13845
   00620 Pyruvate metabolism
    YBT020_13845
Enzymes [BR:btf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     YBT020_13845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 RnfC_N HlyD_D23 GCV_H PYNP_C
Motif
Other DBs
NCBI-ProteinID: ADY22001
UniProt: F0PTQ8
Position
complement(2708582..2709781)
Genome map
AA seq 399 aa AA seqDB search
MAVEVVMPKLGMAMKEGIITSWNIKAGDHVSKGELIASINSEKIETEIEAPADGTVLDIA
VSEDEGVPPGTVICYIGKLNEKVEINESINVVEEKAPNLEPKKVQHPEPYAKEVAKKRIK
ISPVAKKIAKSENLDIKALVGTGPGGRITKVDVLKAIEERVTIPEVLEQEESKVIPVTGM
RKAIANRMHASLQNSAQLTLTMKVDVTDLVALHKEIASVVQKRYDNKLTITDFVSRAVVL
ALGEHKEMNSAYMDDTIHQFEHVHLGMAVALEKGLVVPAIRFANNLSVVELSKQIKNVAQ
KAREGSLSSDDMQGTTFTISNLGSFGIEYFTPVLNTPETGILGVGAIEHVPVYKGKKIKK
GSMLPLSLTFDHRVLDGAPAAAFLRTIKRYLEEPVTILL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggctgtagaagttgtaatgccgaagttaggtatggcgatgaaagaaggtattattacg
agctggaatattaaagcaggcgatcatgtatcaaaaggtgaactaattgctagtattaat
tcggaaaaaatcgaaactgaaatagaagcaccagcggatggaactgttcttgatatagct
gtaagtgaagatgagggagttccacctggcactgtcatttgctatatcggtaagctgaac
gaaaaagtagaaatcaatgaaagtataaatgttgtagaagaaaaagcacctaatctagag
cctaaaaaggtccaacatccagaaccatatgcgaaagaagtggcgaagaaaagaatcaaa
atttcacctgtagcgaagaaaattgcaaagtctgaaaatctagatatcaaagcattagtt
ggtacaggccctggcggaaggattacaaaagtagacgtattaaaagcgattgaagaaaga
gtaacaattccagaagtacttgaacaagaagaaagtaaagtaattcctgttactggtatg
cggaaagcaatcgcaaaccgtatgcatgcaagtttacaaaatagtgcgcaattaacatta
acgatgaaagtagatgttacagatttagttgctttacataaagaaatagcgtcagttgta
caaaaacgatacgataacaaactaactattacggatttcgtttctcgtgctgttgtatta
gcgcttggagagcataaagaaatgaacagtgcttatatggatgatacaattcatcaattt
gaacatgttcatttaggcatggcagtcgcattagaaaaaggattagtcgttccagctatt
cgctttgctaataatctatctgtagtagagttatctaaacaaattaaaaacgttgcacaa
aaagcaagagaaggtagtttaagtagtgatgatatgcaagggacaacctttacaattagt
aatttaggtagcttcggtattgaatattttacgccagtattaaatacacctgaaactggt
attttaggtgtaggtgcaattgaacatgttccagtatataaagggaagaaaataaaaaaa
ggcagtatgttacctttaagtttaacattcgatcatcgtgtattagatggtgcaccagca
gctgcatttttacgcacaattaaacgttatttagaagaacctgtaacaattcttttataa

DBGET integrated database retrieval system