KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_14925Help
Entry
YBT020_14925      CDS       T01839                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:btf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    YBT020_14925
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    YBT020_14925
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    YBT020_14925
Enzymes [BR:btf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     YBT020_14925
Exosome [BR:btf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YBT020_14925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2902850..2904523)
Genome map
AA seq 557 aa AA seqDB search
MFVLGLKMKKLLLAGTITLSMLCTESMMNDYTVEAKVKKVERQPKNVIIMVMDGTSSSAT
TLARLYKGKPLALDEIVTGGVRTYSAESAITDSAPAATALATGNKSNSGYVGVLPTIVSS
PGLKSIKEEDKLRPVANVLEGAKRTGRATGIVATAEIQHATPAGFSAHHVNRKHFDVIAE
QQVYQNIDVVLGGGKAALLPERDSGIRKDGEDLVKVIQNKGYDFIETKEALLKSKANKIW
GSFSHNALAFDMDREATTPEQPTLSQMTEKAIQTLSKDKDGFFLFVEGSKPDWAAHVNDP
IGMISDVLAFDNAVAEALRFAKKDGNTMLIAVADHGNSGISIGNMNTTKGYNTTPVSTYI
DPLKKAKMTLEGTINNLKSDLSNVEDVAKLYGLDHLTYGEKERLQAAKKKIDVGPIFTTL
LANRANIGFTTGGHTGEDVFLYSYGPQKPVGLIQNTDVAKTIAKAMGFNLEEVTNKLFVE
SELAFKQNGATVTIDKTDVANPVLIVKHNNVTAQLFVNKNIIRIKNKDYELGSVVVESNG
KFYVPEEARRLFIKHSR
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtattgggtttaaagatgaagaagttactgttagcaggaacgatcacactaagt
atgttatgtactgaaagtatgatgaatgattatacggtggaagcgaaagtgaaaaaagta
gaacgtcaaccgaaaaatgtaatcataatggttatggacggaacgagttcttcagcaact
acattagctcgcttgtataaagggaaaccacttgcattagatgaaattgtaacaggagga
gttcgtacatattcggcggaatcagctataacagactcagctccagcagctacagcttta
gcgacggggaataaatcgaattcaggatatgtaggggtattacctactattgtgagttca
cctggcttaaaatcaataaaagaagaggacaagttacgtccagttgccaacgttttagaa
ggtgcgaaacgtactggtcgcgcaactggaattgttgctacagctgaaattcagcatgct
actcctgctgggttctctgctcaccatgtaaaccgtaagcattttgacgtaattgcagag
caacaagtgtatcaaaatatagatgtcgtattaggcgggggaaaagcagcacttttacct
gagagagatagtgggattcgaaaagatggtgaagatttagtaaaagtgattcaaaataaa
ggctacgactttattgaaacgaaagaggcattattgaaatccaaagctaataaaatttgg
ggctctttctcacataatgctttagcgttcgatatggatcgtgaagcaacaactccagag
caaccaacactctctcaaatgacggaaaaagcaattcaaacgttatcaaaagataaagat
ggcttctttttatttgtggaaggaagtaaaccagactgggcagcccatgtgaatgatcca
attgggatgattagtgatgtgttagcatttgataatgcagttgcagaagcattaagattt
gcaaaaaaagatggtaatacgatgctaatagccgtagcggaccatggtaacagcggtatt
tctattggcaatatgaatacgacaaaaggttataatactacgccagtctctacatatatt
gatccattgaaaaaagcgaaaatgacacttgaagggactataaataatttgaaatctgat
ttatcaaatgtagaagatgtagctaagttatacggcttggatcatttaacttatggtgaa
aaagagaggttacaagcggctaaaaagaaaatagatgtaggtccaattttcactacatta
ttggctaaccgtgcgaacataggctttacaacaggaggtcatactggtgaggatgtattt
ttatattcatacggtcctcaaaagccagttggtttgattcaaaacacggacgttgcaaag
acaatagcgaaagcgatgggctttaatttagaagaagtaacaaacaaattatttgtagag
agtgaattagcctttaagcagaatggtgcaactgtaacaatagataaaactgatgtagcg
aatcctgtactcatagtaaaacataataatgtaacagctcaattatttgttaacaaaaat
ataattcgtattaagaataaagattatgaactaggaagtgttgttgtagaaagcaatggt
aagttctatgtaccagaagaagcaaggcgtttattcataaagcattctcgttaa

DBGET integrated database retrieval system