KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_15790Help
Entry
YBT020_15790      CDS       T01839                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btf00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    YBT020_15790
Enzymes [BR:btf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     YBT020_15790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3084978..3085628)
Genome map
AA seq 216 aa AA seqDB search
MLSVINDLKLYANKIVQTGLVVGAGGNLSMRDGNMMYISPSGFDLQEIEDHEWVRVNIET
GEILDNLKPSSEILMHLECFRKRPDITAVLHAHPSYSVGVSCTGHTIPSLFPDFPAMIKS
VSYLEYMIPTTEVLATAVSNVIEENDVVVMRNHGVLTVGKTMKEAYFLMQILEEAAKVYT
IASTVGVPRILTEEECHELRNLSSEKYRLQLLKDAE
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
ttgctgagtgtaataaatgatttgaaattatatgcaaataagattgtccaaacgggtctt
gtagtaggagcaggtggaaatttaagtatgagagacggaaatatgatgtatatctctcct
agcggttttgatttgcaagagatagaagaccacgagtgggtacgtgtcaatattgaaacg
ggtgagatattggataatttaaaaccatcttctgaaatattaatgcatctggaatgtttt
cgtaaacgtcctgatataacagctgttttacatgctcatccaagttattcggtaggtgta
tcatgtactggtcataccattccgagtctattcccagattttccagcaatgatcaaaagc
gtatcttatcttgaatatatgattccgactacagaagtattggctactgctgtatcaaat
gtgattgaagaaaatgatgtagtcgtaatgaggaatcacggggtacttacggttggtaaa
acaatgaaagaagcatattttctaatgcaaattctagaagaagcggccaaagtatatacg
attgcatcgacggtgggcgtgccaagaattttgacagaggaagaatgtcacgaattaaga
aatctatcttctgagaaatatagattacaactattaaaagatgcggagtaa

DBGET integrated database retrieval system