KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_19230Help
Entry
YBT020_19230      CDS       T01839                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:btf00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:btf00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3777844..3779319)
Genome map
AA seq 491 aa AA seqDB search
MKLHTLVSCLHDFPVVPKENPEITSIEADSRKVKEGSLFVCMKGYTVDSHDFAKQAAAQG
AAAIVAERPIDVDVPVVLVKNTFRSLAVLADYFYGQPTHKLHLIGITGTNGKTTTSHIMD
EIMRAHGHKTGLIGTINMKIGDETFEVKNTTPDALTLQQTFAKMVEHGVDSTVMEVSSHA
LDLGRVHGCDYDVAVFTNLTQDHLDYHKTMEEYKHAKGLLFAQLGNSYNHNREKYAVLNN
DDAVTAEYMRSTAATVVTYGIDTTSDVMAKDIVMTSGGTTFTLVTPYESVNVTMKLIGKF
NVYNVLAATAAGLVSGVSLETIIDVIKELAGVPGRFEVVDGGQNYTVIVDYAHTPDSLEN
VLKTAKQFAKGDVYCIVGCGGDRDRTKRPIMASVATRYATHAIYTSDNPRSEEPGAILDD
MVHGANGKNYEVIIDRKEAIYHAIANAKAEDIIIIAGKGHETYQIIGKDVHHFDDREIAK
EAITERLNNEE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgcatacacttgtatcatgtttgcatgattttccagttgttccaaaagaaaat
ccagaaatcacatctatagaagctgattcacgtaaagtgaaagaaggaagcttatttgta
tgtatgaaaggatatacggttgatagccatgattttgctaagcaagcagcggcacaagga
gcggctgctattgttgcggaaagaccaattgatgttgacgttccagttgtacttgtgaaa
aatacttttcgttcgttagcggttttagctgattatttttatggtcaaccaacacacaag
ttacatttaatcggtattacaggtacaaatggaaagacaacaacatcgcatattatggat
gagattatgcgcgcacatggtcataaaacggggctaattggaacgattaatatgaaaatc
ggtgatgaaacatttgaggtgaaaaatacaacaccagatgcactaacacttcaacagacg
tttgcaaaaatggttgaacacggtgtggatagcacagtaatggaagtttcgtcacatgct
ttagatcttggccgtgtacacggatgtgattacgatgtcgcagtgtttacaaatttaaca
caagatcatttagactatcataaaacgatggaagaatataaacatgcaaaagggttgcta
tttgcgcaacttggcaatagttataatcataatcgtgaaaaatacgcggtattgaataac
gatgatgctgtaacagcggaatatatgagaagtactgcagcaactgttgtaacgtatgga
attgatacaacaagtgatgttatggcaaaagatatcgttatgacaagtggtggaactaca
tttacgcttgtaacaccgtatgagagtgtaaatgttacgatgaaattaattgggaaattt
aatgtatataacgtactagctgcgacagcggcaggacttgtttctggtgtaagtttagaa
acaatcattgatgtaataaaggaactagctggagttccaggacgttttgaagtagttgat
ggtggacaaaattatacagttattgttgattatgcacatacaccagatagcttagaaaat
gtattaaaaacagcaaaacagtttgcaaaaggtgacgtatattgcatcgtcggttgtggc
ggtgatagagatagaacgaagagaccaatcatggcaagtgttgcaacacgatatgcaact
cacgccatttacacttcagataatccaagaagtgaagagccaggagctattttagatgat
atggtacatggtgcaaatggaaaaaattatgaagtaattattgatagaaaagaagcgata
taccatgcaattgctaacgcaaaagctgaagatattatcattattgctggtaagggtcat
gaaacatatcaaattattggtaaagatgttcatcattttgatgatcgtgaaatcgctaaa
gaagcaattacagagcgtttaaacaacgaagagtaa

DBGET integrated database retrieval system