KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_19840Help
Entry
YBT020_19840      CDS       T01839                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btf00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    YBT020_19840
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    YBT020_19840
Enzymes [BR:btf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     YBT020_19840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3887547..3888323
Genome map
AA seq 258 aa AA seqDB search
MVTNRVVFLTGAASGIGYEMGKAFAKEGAKVVITDRLEERAKEAAEQLQKEGFQAIGLKC
DVTSEEEIKAAISQTVTHFGSLDILINNAGMQHVSPIEDFPTEKFELLIKIMQIAPFIAI
KHAFPIMKKQKYGRIINVASINGLVGFAGKSAYNSAKHGVIGLTKVAALEGATHGITVNA
LCPGYVDTPLVRNQLQDLATTRNVPLENVLEDVIYPLVPQKRLLQVQEIADYAMFLASEK
AKGITGQAVVIDGGYTAQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggttacaaatcgagttgtttttttaacaggtgctgcaagtggtattggttatgaaatg
ggaaaagcttttgcaaaagaaggtgcaaaagtcgttattaccgatcgtcttgaagaacgt
gcaaaagaagctgctgaacaattgcaaaaagaaggctttcaagctatcggcttaaaatgt
gatgttacatccgaagaagaaattaaagctgcaatttctcaaactgttactcatttcggc
tcattagacatattaattaataacgcaggcatgcaacacgtttcaccaattgaagatttt
ccgaccgaaaaattcgagctactaattaaaattatgcaaatcgctccttttatagcaata
aagcatgccttcccaatcatgaaaaagcaaaagtatggtcgtattattaatgtcgcttcc
attaatggcctcgttggatttgcagggaaatccgcctacaatagcgcgaaacatggtgta
attggattaacaaaagttgccgctttagaaggcgctactcatggaattaccgttaacgcg
ctttgtccaggctatgtcgatacacctcttgtacgcaatcaactacaagatttagctacg
acacgaaatgtaccacttgaaaatgtgttagaggatgtcatttatccacttgtcccacaa
aaacgcttattacaagtacaagagattgctgattatgcgatgtttttagcgagcgaaaaa
gcaaaaggtataactggtcaggctgtcgttatcgatggtggttatactgctcaataa

DBGET integrated database retrieval system