KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_22240Help
Entry
YBT020_22240      CDS       T01839                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K13767  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
btf00071  Fatty acid degradation
btf00362  Benzoate degradation
btf01100  Metabolic pathways
btf01120  Microbial metabolism in diverse environments
btf01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:btf00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    YBT020_22240
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    YBT020_22240
Enzymes [BR:btf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     YBT020_22240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADY23676
UniProt: F0PZ58
Position
complement(4333645..4334421)
Genome map
AA seq 258 aa AA seqDB search
MLKFLSVRVEDHIAVATLNHAPANAMSSQVMHDVTELIDQVEKDDNIRVVVIHGEGRFFS
AGADIKEFTSVTEAKQATELAQLGQVTFERVEKCSKPVIAAIHGAALGGGLEFAMSCHMR
FATESAKLGLPELTLGLIPGFAGTQRLPRYVGKAKACEMMLTSTPITGAEALKWGLVNGV
FAEETFLDDTLKVAKQIAGKSPATTRAVLELLQTTKSSHYYEGVQREAQIFGEVFTSEDG
REGVAAFLEKRKPSFSGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaattcctatctgtaagagttgaagatcatatcgcggtggctacgttaaatcat
gcgccagctaacgcgatgtcttcacaagttatgcatgacgttactgaattaattgatcaa
gtggagaaggatgataacattcgtgttgttgttattcacggtgaagggcgcttcttctcg
gcgggagcagatattaaagaatttacatctgttactgaagcgaagcaagcgactgaatta
gcgcagcttggacaagttacgtttgagcgcgttgaaaaatgttcaaaaccagttatcgcg
gcaattcatggagcggcacttggcggcggccttgagtttgctatgtcttgccacatgcgc
tttgcaactgaaagtgcaaaacttggtttacctgaattaacacttggattaattcctgga
tttgcaggtacacagcgattaccacgttatgttgggaaagcgaaagcttgtgaaatgatg
ttaacaagtacaccgattactggtgcagaagcattaaaatggggactagttaacggagtt
tttgctgaagaaacatttttagatgatacgcttaaagttgcaaaacagattgctggaaaa
agcccagcgacgactcgtgctgtactagagttattgcaaacgacgaaatcgtctcattat
tatgaaggtgtacaacgcgaagctcaaatctttggtgaagtatttacgagtgaagatgga
agagaaggtgtagcggcgtttttagaaaaacgtaagccttcatttagcggcaggtag

DBGET integrated database retrieval system