KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_22855Help
Entry
YBT020_22855      CDS       T01839                                 

Definition
(GenBank) acetate--CoA ligase (acetyl-Co A synthetase)
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
btf00010  Glycolysis / Gluconeogenesis
btf00620  Pyruvate metabolism
btf00640  Propanoate metabolism
btf00680  Methane metabolism
btf01100  Metabolic pathways
btf01110  Biosynthesis of secondary metabolites
btf01120  Microbial metabolism in diverse environments
btf01130  Biosynthesis of antibiotics
btf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:btf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YBT020_22855
   00620 Pyruvate metabolism
    YBT020_22855
   00640 Propanoate metabolism
    YBT020_22855
  Energy metabolism
   00680 Methane metabolism
    YBT020_22855
Enzymes [BR:btf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     YBT020_22855
Lipid biosynthesis proteins [BR:btf01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   YBT020_22855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADY23799
UniProt: F0PK93
Position
complement(4454043..4455629)
Genome map
AA seq 528 aa AA seqDB search
MKREELLAPPSYNLVSEIEKYTGDKEKLALIWQDDKGNRREVTYAELMKGANKIGNAFIK
SGLQKGDKLLIMMPRLIEAYMTYIAAIKAGFVVIPSSEMLRKKDIEYRIGHGEVKAIVSY
EPYIGQFDDIEAMESLQKFVLSEQSVDGWMNLKTALETESDTLEMAKTDKEDMVFLSYTS
GTTGNPKGVVHTHAWAYAHLRTSAPNWLGIEENDVVWATASPGWQKWIWSPFLATLGSGA
TGFVYHGKFEPKTYLNLLDDNKVNVLCCTPTEYRLMAKVENLSEYNLEALHSAVSAGEPL
NREVIETFQKHFHITVRDGYGQTENTLLVGVMKGMDIRPGSMGKPTPGNHVDIVDEEGMP
VRVGEVGDIAVHIETPALFKQYYKDDERTAMQFRGDYYITGDKAKKDEDGYFWFEGRGDD
IIISSGYTIGPFEVEDALVKHPYVRECAVVASPDEIRGSVVKAFIVLRENIEKNEETLIP
ILQQHVKELTAPYKYPRKIEFVDELPKTISGKIRRIELRKQEMEIPSK
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaagagagaggaattgttggcaccgccgtcttataatttagtttctgaaatagagaaa
tatacaggtgataaagagaaacttgctttaatttggcaagatgataaagggaatcgacga
gaagttacatacgctgagttaatgaaaggtgcaaataaaattggaaacgcttttataaag
agtggtctgcaaaaaggggacaagctcctcattatgatgcctcgtttaattgaagcatac
atgacgtatatcgctgcgattaaagcaggatttgtcgtaattccgagttcggaaatgtta
cgcaaaaaggatattgaataccgcattggacacggggaagtaaaagcaatcgtaagttat
gagccgtacattggacagtttgatgatatagaagcgatggaatctcttcaaaaattcgtt
ctgagcgagcagtcagtagatggatggatgaatttaaaaacagcgttagaaacagaaagt
gacacgttagagatggcaaagacagataaagaagatatggtctttttatcgtatacgtca
ggaacgacaggaaatccaaaaggtgttgttcatacgcatgcgtgggcatatgctcactta
cgtacgagcgctccaaattggctcggaattgaagagaatgatgttgtatgggcaacggct
agtccaggatggcaaaagtggatttggagcccgtttttagcaactctaggctcgggggca
acagggtttgtataccacggtaagtttgaaccaaaaacgtatttaaatttattagacgat
aataaggtgaatgtgctttgttgtacgccaactgagtatagattaatggcaaaggtagaa
aatttaagcgagtacaatttagaagcgttacatagcgctgtatccgcaggtgagccatta
aatagagaagtcattgaaacgttccaaaagcactttcatattacagtgagagacggctat
gggcaaacggaaaacacattgcttgttggtgtaatgaaagggatggatattagaccagga
tcaatggggaaaccgacgccaggcaaccacgttgatattgtagatgaggaagggatgccg
gtaagggtaggcgaagttggtgatattgcggttcacattgaaacaccagccctctttaaa
caatactataaagacgatgagcgcacagcgatgcaattccgcggtgattattatattacc
ggtgataaagcaaagaaagatgaagacggctatttctggtttgaagggcgcggtgatgat
attattattagctctggttatacaatcgggccgtttgaagtagaagatgcgctcgtaaag
cacccttacgtgagagaatgtgcggttgtcgcaagtcctgatgaaattcgcggaagtgtc
gtgaaggcatttatcgtattaagagagaatatagaaaagaacgaagaaacattaattcca
atactccaacaacacgtcaaagaacttactgcaccatataaataccctcgcaaaattgaa
tttgtagatgaactaccaaaaacgatttctggaaaaatccgccgtattgaacttagaaaa
caagagatggagattccgtcaaaataa

DBGET integrated database retrieval system