KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_23155Help
Entry
YBT020_23155      CDS       T01839                                 

Definition
(GenBank) dipeptidase PepV
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
btf00300  Lysine biosynthesis
btf01100  Metabolic pathways
btf01120  Microbial metabolism in diverse environments
btf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:btf00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    YBT020_23155
Enzymes [BR:btf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     YBT020_23155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ADY23859
UniProt: F0PL43
Position
complement(4510473..4511879)
Genome map
AA seq 468 aa AA seqDB search
MSAINWTEEVAKRKDDLIRDTQQFLQIKSVWEEESAKEGAPFGEGVEKALSFMLHKGETE
GFTSKNLEGYAGHLEMGQGEELVGILCHVDVVPEGDGWTTPAYSADIRDGKIFARGAIDD
KGPTMAAYYAMKIVKELGLPLSKRVRMILGTDEESNWKCVDHYFKNEEMPTIGFAPDADF
PIINAEKGISDIQVVQNGSGEKKGTYELVSFESGRRLNMVPDFAEAVVTGEDVNALTVAY
EEYLQTAKKIGEAIVEGNTVTLQIKGISAHGSTPEKGENAGLLLANFLTKVALDGKGASF
ATFVAATFIGDIYGKKATIAYKDEVSGPLTVNVGRLSYTKENGGNLGLNVRYPVTTNFEE
MIAKLKEYVGTHGFEVDDYSNSRPHHVDKDHVLIRTLQRVYEEQTGEKAELLAIGGGTYA
RSLKAGVAFGPLFPGKEELAHQKDEYIEIEDLLKATAIYAQAIYELAK
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaattaattggacagaagaagttgcaaaacgaaaagatgatttaattcgtgat
acacaacaatttttacaaattaaaagtgtatgggaagaagagtcggcaaaagagggcgca
ccgttcggtgaaggtgtagaaaaagctttatctttcatgttacataaaggagaaacggaa
ggttttacttctaaaaatttagaagggtatgcaggtcatcttgaaatgggacaaggagaa
gaattagtaggtattctttgtcacgttgacgttgtaccagaaggagatggttggacgact
cctgcatatagtgcagatattcgcgatggaaagatttttgcacgcggtgcaattgacgat
aaaggcccaacgatggcagcttactatgcgatgaaaattgtgaaagaattaggtttacct
ctttcaaaacgcgttcgtatgattttaggaacagatgaggaaagtaattggaaatgtgta
gatcactactttaaaaacgaagaaatgccaacaatcggttttgcgccagacgcggacttt
ccaattattaatgcagaaaaaggaatttctgatatacaagttgtgcaaaatggtagtgga
gagaagaaaggtacatatgaacttgtttcatttgagtcaggtcgccgtttaaatatggtt
cctgattttgcagaagcggttgttacaggagaagatgtaaatgcacttacagtagcatat
gaagagtatttacaaactgctaaaaaaataggtgaagcaattgtagaaggtaatacagta
acgttgcaaattaaaggaatttcagctcacggatctactcctgaaaaaggagaaaatgca
ggtttattactggcaaacttcttaacgaaagttgctcttgatggaaaaggggcttcgttt
gcgacatttgtagcagcaacatttattggtgatatttatggtaaaaaggctactatcgct
tataaagatgaggttagtggtccgttaacagtgaatgttggtcgcctttcttatacgaaa
gaaaatggtggcaatttaggattaaacgtacgttacccagttacgactaactttgaagaa
atgattgcaaagttaaaagaatatgtggggactcatggatttgaagtagatgattattca
aactctcgtccgcatcacgttgataaagaccacgtattaattcgtacgttgcagcgcgta
tatgaagaacaaacaggtgaaaaagcagaactattagcaattggcggtggtacttacgct
cgttcgttaaaagctggtgttgcatttggcccattgttccctggaaaagaagaacttgca
catcaaaaagatgagtatattgaaattgaagacttattaaaagcaacagcaatttacgcg
caagcaatttatgaattagcgaagtaa

DBGET integrated database retrieval system