KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_23440Help
Entry
YBT020_23440      CDS       T01839                                 

Definition
hypothetical protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:btf00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    YBT020_23440
Enzymes [BR:btf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     YBT020_23440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4561494..4562297)
Genome map
AA seq 267 aa AA seqDB search
MWNYEAEEAKAVIVIVHGAMEYHGRYEAVAEMWNHNGYHVVMGDLPSHGTTSRNRGHIDS
FDEYIEEVKLWVKEARKYRLPIFLFGHSMGGLIVIRMMQETKREDVDGIILSSPCLGVLA
GPSAPLQAASKILNIIAPKLQFATNLTVEMSTRNHEVRDAMENDSLFLRKVSVRWYSELI
KSIEIAHKKIDDFPDVPLLLMQACEDKLVDKTRVRTWFNNVKISDKAFKEWPNCYHELLN
EYERDEILNYIQSFTEIRINNIIETNK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtggaattatgaagctgaagaagcaaaggctgtaatcgttatcgtgcacggcgcaatg
gaatatcacggacgctatgaagctgttgcggaaatgtggaatcataacggctaccacgtc
gtgatgggagaccttccgtcacatggaacgacttcaagaaatagaggacatattgattca
tttgatgaatacatagaggaagttaaattatgggtgaaagaggcaagaaagtataggttg
cctatctttttatttggtcatagtatgggtggtcttattgtcattcgtatgatgcaagaa
acgaagagagaagatgtagacggcattattttaagttcgccatgtttaggtgtattagct
ggaccttctgcaccgctgcaagctgcctcaaaaatattaaatattatcgctccgaagtta
caatttgcaacgaatcttacagtggaaatgtcaacgcgtaatcatgaagtgagagatgcg
atggagaacgattcattgttcttgcgcaaagtatcagtacgttggtatagtgaattgatt
aagtctattgaaatcgctcataaaaaaatagatgattttccagatgttccgctcttgcta
atgcaagcatgtgaggataaacttgtagataaaacacgtgtccgcacttggtttaataat
gttaaaataagtgataaggcttttaaagaatggccgaattgttatcatgagttattaaat
gagtatgagcgtgatgaaattttgaattatattcagtcatttactgaaatacgcatcaat
aacataatagaaacaaataagtaa

DBGET integrated database retrieval system