KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_24155Help
Entry
YBT020_24155      CDS       T01839                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
btf00040  Pentose and glucuronate interconversions
btf00052  Galactose metabolism
btf00500  Starch and sucrose metabolism
btf00520  Amino sugar and nucleotide sugar metabolism
btf01100  Metabolic pathways
btf01130  Biosynthesis of antibiotics
Module
btf_M00362  Nucleotide sugar biosynthesis, prokaryotes
btf_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:btf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YBT020_24155
   00052 Galactose metabolism
    YBT020_24155
   00500 Starch and sucrose metabolism
    YBT020_24155
   00520 Amino sugar and nucleotide sugar metabolism
    YBT020_24155
Enzymes [BR:btf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     YBT020_24155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ADY24058
UniProt: F0PNQ9
Position
complement(4701995..4702885)
Genome map
AA seq 296 aa AA seqDB search
MMKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVKSGIEDIIIVTGK
TKRAIEDHFDNAFELEQNLLEKKKYELLEKVQASSKMVDIHYIRQKEPKGLGHAVWCARK
FIGDEPFAVLLGDDIVQAEKPCLRQLIEEYDKTLSSVIGVQTVPEDETHRYGIIDPLEQE
GRRYQVRNFVEKPATGTAPSNLAIMGRYVLTPEIFMFLDQQHVGAGGEIQLTDAIQSLNE
IQRVFAYDFEGKRYDVGEKLGFVQTTIEMALQHPELRDDMVTMMKKILEEQANQES
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaaaaaagtaagaaaagcgataatcccagcagctggattaggaacacgtttttta
ccagcaacgaaagcgatgccgaaagaaatgttaccgattgttgataaaccaactatccaa
tacattgtagaagaagcagtaaaatcaggaatcgaagatattattatcgttactggtaaa
acgaagcgtgctattgaagatcattttgataatgcatttgagttagagcaaaacttatta
gaaaagaaaaagtatgagttacttgaaaaagtacaggcttcttcaaaaatggtagacatt
cactacattcgtcaaaaagaaccaaaaggattaggtcacgctgtttggtgtgcgcgtaaa
ttcattggtgatgagccattcgctgttttattaggtgatgatatcgttcaagctgaaaaa
ccatgtttacgtcaattaattgaagaatatgataaaacgctttcttctgttattggcgta
caaacggttccagaagatgaaacacaccgttacggaattatcgatccgttagagcaggaa
ggacgtcgttaccaagttcgcaatttcgttgagaaaccagcaacaggtacagcaccttca
aacttagcaattatgggacgttacgttttaacacctgaaatcttcatgttcttagatcag
caacatgttggtgctggtggcgaaattcagttaacagatgctatccaaagtttaaacgaa
attcaacgtgtattcgcttacgacttcgaaggaaagcgctacgacgtaggtgaaaagtta
ggatttgttcaaacaacaatcgaaatggcactgcaacacccagaattacgtgatgacatg
gttacgatgatgaagaaaattttagaagaacaagcgaatcaagagtcttaa

DBGET integrated database retrieval system