KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_24670Help
Entry
YBT020_24670      CDS       T01839                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
btf00010  Glycolysis / Gluconeogenesis
btf00260  Glycine, serine and threonine metabolism
btf00680  Methane metabolism
btf01100  Metabolic pathways
btf01110  Biosynthesis of secondary metabolites
btf01120  Microbial metabolism in diverse environments
btf01130  Biosynthesis of antibiotics
btf01200  Carbon metabolism
btf01230  Biosynthesis of amino acids
Module
btf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
btf_M00002  Glycolysis, core module involving three-carbon compounds
btf_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:btf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YBT020_24670
  Energy metabolism
   00680 Methane metabolism
    YBT020_24670
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YBT020_24670
Enzymes [BR:btf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     YBT020_24670
Membrane trafficking [BR:btf04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    YBT020_24670
Exosome [BR:btf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   YBT020_24670
  Exosomal proteins of melanoma cells
   YBT020_24670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF3231
Motif
Other DBs
NCBI-ProteinID: ADY24161
UniProt: F0PPR8
Position
4790386..4790940
Genome map
AA seq 184 aa AA seqDB search
MKKIIVIRHCSATGQERHAELTTDGKKQANTLATFLLENQLQIDHIISSPFVRAIDSIRP
YALQANLSIQEDERLAERILSDIPMDDWMQKLESTFTNIDIAFSGGESTKQATDRAISLI
EDVLKLNHTTILLVTHGNLLTLILKHFDHTIGFHEWRALTNPDMYEITIDEQCSLKRLWK
APSK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattattgtcatacgacattgttcagcaactggccaagaacgtcatgccgaa
ttaacgaccgatggaaaaaaacaagcaaacacccttgctacattccttttagaaaaccaa
ctacaaatagaccatattatttcaagcccatttgtgcgagctatcgattctattcggccc
tatgcactccaagctaatttgtctatccaagaagatgaacgattagctgaacgcatatta
agcgacattccaatggacgattggatgcaaaaactagaatctacttttacaaatatagat
attgccttttcaggcggagagtcaacaaaacaagcaacggaccgtgctatatcgcttatc
gaagacgttttaaaattaaaccatactacaatattactcgttacacacggaaacttactt
acgctcattttaaagcactttgatcatacgatcggctttcatgaatggagagctttaacg
aatcctgatatgtacgaaattacaattgatgaacaatgtagcctaaaacgattatggaaa
gcaccgtccaagtaa

DBGET integrated database retrieval system