KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_24670Help
Entry
YBT020_24670      CDS       T01839                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:btf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YBT020_24670
   01230 Biosynthesis of amino acids
    YBT020_24670
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YBT020_24670
  Energy metabolism
   00680 Methane metabolism
    YBT020_24670
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YBT020_24670
Enzymes [BR:btf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     YBT020_24670
Exosome [BR:btf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   YBT020_24670
  Exosomal proteins of melanoma cells
   YBT020_24670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4790386..4790940
Genome map
AA seq 184 aa AA seqDB search
MKKIIVIRHCSATGQERHAELTTDGKKQANTLATFLLENQLQIDHIISSPFVRAIDSIRP
YALQANLSIQEDERLAERILSDIPMDDWMQKLESTFTNIDIAFSGGESTKQATDRAISLI
EDVLKLNHTTILLVTHGNLLTLILKHFDHTIGFHEWRALTNPDMYEITIDEQCSLKRLWK
APSK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattattgtcatacgacattgttcagcaactggccaagaacgtcatgccgaa
ttaacgaccgatggaaaaaaacaagcaaacacccttgctacattccttttagaaaaccaa
ctacaaatagaccatattatttcaagcccatttgtgcgagctatcgattctattcggccc
tatgcactccaagctaatttgtctatccaagaagatgaacgattagctgaacgcatatta
agcgacattccaatggacgattggatgcaaaaactagaatctacttttacaaatatagat
attgccttttcaggcggagagtcaacaaaacaagcaacggaccgtgctatatcgcttatc
gaagacgttttaaaattaaaccatactacaatattactcgttacacacggaaacttactt
acgctcattttaaagcactttgatcatacgatcggctttcatgaatggagagctttaacg
aatcctgatatgtacgaaattacaattgatgaacaatgtagcctaaaacgattatggaaa
gcaccgtccaagtaa

DBGET integrated database retrieval system