KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_26775Help
Entry
YBT020_26775      CDS       T01839                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
btf00330  Arginine and proline metabolism
btf01100  Metabolic pathways
Module
btf_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:btf00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    YBT020_26775
Enzymes [BR:btf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     YBT020_26775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: ADY24577
UniProt: F0PVB6
Position
complement(5225743..5226615)
Genome map
AA seq 290 aa AA seqDB search
MRFDEAYSGKVFIKSHPSFEESKVVIYGMPMDWTVSYRPGSRFGPARIREVSIGLEEYSP
YLDRELEEVKYFDAGDIPLPFGNAQRSLDMIEEYVSKLLDADKFPLGLGGEHLVSWPIFK
AMAKKYPDLAIIHMDAHTDLRESYEGEPLSHSTPIRKVCDLIGPENVYSFGIRSGMKEEF
EWAKEVGMNLYKFDVLEPLKEVLPKLAGRPVYVTIDIDVLDPAHAPGTGTLEAGGITSKE
LLDSIVAIANSNINVVGADLVEVAPVYDHSDQTPVAASKFVREMLLGWVK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttgatgaagcttattcaggtaaagtatttattaaaagtcatccaagttttgaa
gagtcaaaggtagttatttatgggatgcctatggattggacagtaagttaccgtccggga
tctcgttttggccctgcacgtattcgtgaagtatcaatcggtcttgaagaatatagtccg
tatttagatcgtgaactagaagaggtaaaatattttgatgcgggtgatatcccattacca
ttcggaaacgcacagcgcagcttagacatgattgaagaatatgtatcaaaacttttagat
gccgataagtttccactaggtctcggcggtgagcacttagtgtcttggccaatttttaag
gcaatggcaaaaaaatatccggatttagcaatcatccatatggatgctcatactgattta
cgtgaatcgtatgaaggggagcctttatcccactctacaccaattcgtaaagtgtgtgat
ttaattggtccggaaaacgtatattctttcggaattcgttctggaatgaaggaagaattt
gaatgggcgaaagaagtaggtatgaacttatataaatttgacgtattagaaccgttaaaa
gaagtattaccgaaacttgcaggacgcccagtctatgtcacaatcgacattgatgtatta
gacccagctcacgctccaggaacaggaacgttagaagctggtggtatcacatctaaagaa
ttattagattccatcgtagcaattgcaaattcaaatataaatgtagttggagcagactta
gtagaagtagctcctgtctacgaccatagtgatcaaacaccagtcgcagcaagcaaattc
gtgcgggaaatgctgctcggttgggtgaaataa

DBGET integrated database retrieval system