KEGG   Bacillus thuringiensis Bt407: BTB_502p01490Help
Entry
BTB_502p01490     CDS       T02277                                 

Definition
helicase, RecD/TraA
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:btg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BTB_502p01490
Enzymes [BR:btg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BTB_502p01490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
BTB_502p:complement(91759..94338)
Genome map
AA seq 859 aa AA seqDB search
MSVFNLENYLSEPKSALDDFEVDDEITIVTLPLDTIYENSESGYRVYACQSEEGQSFKMN
GKFIMPLNPNIHYQVNGVIVFYKGEKQVKMNRVSPIKPIGKRGIVRYLRTLKGLKNRAED
IYSVFGDKSIDMLIENPEEVVSRIKGIGKKSVEAWKKQLESLTNSQYTLSYLLDIGLSFE
QSKSLYSEYKDDIIRLISENPYLLARKIPGYGFKKCDKIAKDIHFDMLSDERIQEGIIHG
LDEATKEGHCFLHKDDLIEKTREILRVTLPSKESERLLKETIDEKISYYFGTIQVMIPRD
ELNAYYERWKSARYKNEKEKCLYPLFDIPYELIEEEIENLLTFERIVIEQDRVYLEYIHS
AEVRVAEELYRLSDTQEWKNQIDIKAELDKYLSAEGIELEEKQEEAILTFTKRRGGFYVL
NGSAGCGKTFVLKIILKIFNIVCKSNGITPYLQLLAPTGKAAKVAKKSTNEICLTVHRGL
EFRGGEGFTFNASNPLPGNIIVLDESSFLDVELSKDLLQAIKRGATVIWMGDIKQLPSIG
PGSVLKDIIESGVLPVVTLDVVKRQGKQSGIAKNAKKIIDGEMIETCEDTKDSYAVFRDS
PKVILKNILESVKRVLTFPDYTLDDIQVLSPQKTGILGTYMINLLMQEAFNETESTVTSL
NKEFTVDNERFSLYFKEGDKVINMRNNDLKVWYKKSYVSTEDSNVLLTQYTPNKDAKGGI
ANGETGVIEAIRKIKEPVDNKETIKGAVPAKTKEIIRIIVKYDDGYIFYDNKEKEDLDHA
YAFSIHKSQGSQWRACIMPISMLHYRMLDNSLFYTGFTRAQEFNVVIGEERAIKHAIKTY
KSRERNTTLKERLESLYLI
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
ttgtctgtatttaatttagaaaattatcttagtgaaccaaagtcagctttagatgatttc
gaagtcgatgatgaaattaccattgtcacccttccacttgatacaatttacgaaaattca
gaatcgggttatcgtgtttatgcttgtcaaagtgaagaaggtcagtcatttaaaatgaac
ggaaaattcatcatgccacttaatccgaatattcactatcaggtaaatggagttattgta
ttttataaaggtgaaaaacaagtaaaaatgaatcgggtttcacctataaagccaattggg
aaaagaggcatcgttcgttacttacgaactttaaaaggtctgaaaaatagagcagaggat
atttatagcgttttcggtgataaatctattgatatgttgatagaaaaccctgaagaagtt
gttagtcgaattaaagggattggtaaaaaaagtgtggaagcttggaaaaaacaacttgaa
agtctaacaaattcacagtatacattgtcttatttattagatattggtttgtcgtttgag
caatcaaaaagcttatacagcgaatataaagatgatatcattcgtttaatttcagaaaat
ccttatcttttagcaaggaaaattccaggatacggatttaaaaaatgtgacaaaatcgct
aaagatattcactttgacatgctaagtgatgaacgtattcaagaagggattattcatgga
cttgatgaggcaacaaaagaaggtcactgcttcttacataaagatgatttaattgaaaaa
acaagagagatattgagagttacacttccttctaaagaaagcgaacgtttattaaaagaa
acaatagatgaaaaaatctcttattactttggtacaatccaagttatgattccaagggat
gaactaaacgcttattatgaacgttggaaatcagctcgttataaaaatgaaaaagaaaag
tgtttatatcctttatttgatattccatatgaactgattgaggaagaaattgagaatttg
cttacttttgagagaattgtcatagaacaagaccgtgtgtatttagaatacatccatagt
gctgaagtccgtgtggcagaagagctttatcgtctttcagatacgcaagaatggaagaat
caaatagatattaaggctgaattagacaagtatctatctgctgaaggtattgaattagaa
gaaaaacaagaagaagccattttaacattcacgaaaagacgtggtggtttttatgtacta
aatggttccgcaggttgtgggaaaacattcgttttaaaaatcatattgaaaatcttcaat
attgtatgtaaatcaaatggcattactccctaccttcaattattggctccaactggaaag
gccgctaaagttgctaagaaatcaacaaatgaaatatgtcttactgtacatagaggatta
gaattccgtggaggagaaggatttaccttcaatgcatccaatcctttaccagggaacatt
atcgttttagatgaaagctcgtttttagatgtggaattatctaaggatttactacaagca
attaaacgtggtgctacagttatctggatgggcgatattaaacagttgccgagtattggt
ccaggcagtgttctaaaagatatcattgaaagtggagttcttccagttgttacattagat
gtagtaaagcgtcaaggaaagcaatcaggtattgcaaaaaacgcaaaaaaaatcattgat
ggtgaaatgattgaaacttgcgaggatacaaaggattcctatgctgtatttcgtgattca
cctaaggttattttgaagaacattctcgaatctgttaaacgtgtccttacgttccctgat
tatacactggatgatatccaagttctatcacctcaaaaaacaggtattttaggaacatat
atgattaacttgttaatgcaagaagcttttaacgaaactgaatcaactgttacttcttta
aataaagaattcactgtagataatgaacgtttttctctgtactttaaagaaggcgataaa
gtcattaacatgcgtaataacgacttaaaagtttggtacaaaaaaagttacgtttcaact
gaagacagtaacgttcttcttacccaatatacaccgaataaagatgctaaaggtggcatt
gcaaacggtgaaactggtgtaattgaagcaatccgaaaaatcaaagaaccagttgataat
aaggagactataaaaggtgctgttcctgcaaaaacgaaggaaatcattcgtataattgta
aaatacgatgatggttatatcttctatgataacaaggaaaaagaagatttagaccatgca
tacgcattctctattcacaagtctcagggttcacaatggagagcttgtatcatgccaatt
tctatgcttcactacagaatgcttgataatagcttgttctatactggatttacacgagct
caagaatttaatgtggtaattggtgaagaaagagcgattaaacacgcaattaaaacgtac
aagtcaagagagcgtaacaccactctaaaagagcgtttagaaagtttatatctcatttaa

DBGET integrated database retrieval system