KEGG   Bacillus thuringiensis Bt407: BTB_502p06140Help
Entry
BTB_502p06140     CDS       T02277                                 

Gene name
gmk
Definition
guanylate kinase Gmk (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:btg00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BTB_502p06140 (gmk)
Enzymes [BR:btg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BTB_502p06140 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
BTB_502p:complement(371212..371757)
Genome map
AA seq 181 aa AA seqDB search
MEKEIFILVGPSGSGKTTLGKTLEERMDIPEVISHTTRKPRAGEVDGKDYYFVSNKTFDE
LDKIESVVYAGNSYCVSREEIDSKLKMHDRIYVVTDINGAMQVKKAYGEIVTIIFISLSL
IRMAWRMFKRGDSFSKIKDRILYCVKNKERMNHVHADYIVVNNNFESSVQELNKIVSKKI
V
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagaaatatttattttggtgggaccatcagggagtggaaaaacaacattagga
aaaacgttagaggaaagaatggatattcctgaagtaatttctcatactacaagaaagcca
agggcaggggaagtagatgggaaagactattatttcgtttcaaataaaacgtttgatgaa
ttggataaaatagaaagtgttgtatatgcagggaattcatattgtgtcagtagggaagag
atagatagtaaattaaagatgcacgatagaatctatgttgttactgatattaatggggct
atgcaggttaaaaaggcatatggtgaaattgtaacgattatatttatttctctttccttg
attcgtatggcgtggaggatgtttaaaagaggggattcttttagcaagataaaagataga
atcctatattgtgttaaaaataaagagagaatgaatcacgtacatgcagattatatagtt
gtaaataataactttgaaagttctgtacaagaattgaataagattgtttcgaaaaagata
gtctaa

DBGET integrated database retrieval system