KEGG   Bacillus thuringiensis Bt407: BTB_c00200Help
Entry
BTB_c00200        CDS       T02277                                 

Gene name
dck
Definition
deoxyadenosine/deoxycytidine kinase Dck (EC:2.7.1.74 2.7.1.76)
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:btg00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:btg00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(22158..22826)
Genome map
AA seq 222 aa AA seqDB search
MNLRQKYDIPNDAVITIAGTVGVGKSTMTTALANALGYRTSFEKVDSNPYLDKFYADFTR
WSFHLQVYFLAERFKEQKRIFEYGGGFVQDRSIYEDTGIFAKMHHEKGTMTETDYETYKG
LFDAMVMTPYFPHPDLLIYLEGSFDDIVDRIQERGRPMEQQTPIEYWKEMHGRYENWINN
FNSCPVLRLNINEYDILKDGDSIEPIIKKIGHFLKQTRKLVK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaggcaaaaatatgatatacccaatgacgcagtaatcactatcgccggaacg
gtaggtgtgggtaaatcaactatgacaactgcattagctaatgctttaggttatcgcaca
tcatttgaaaaagtagattccaatccatacttggacaagttctatgcggacttcactcgc
tggagcttccacctacaagtgtactttttagcagaacgatttaaggaacaaaaaagaatt
tttgaatacggtggcggttttgttcaagatcgttctatttacgaagacactggaattttc
gcaaagatgcatcatgaaaaaggtacgatgacggaaactgattatgaaacatacaaaggg
ttatttgacgctatggtcatgactccttacttccctcatccagacttattaatttactta
gaaggttctttcgatgatattgtcgatcgtattcaagaacgcggacgcccaatggaacag
caaacgccaattgagtactggaaagaaatgcatggacgttatgaaaactggattaacaac
tttaattcatgccctgtattacgcttaaatattaatgagtacgatattttaaaagatggg
gattcaatcgaaccaatcattaaaaaaattggccattttttaaaacaaacacgtaaactt
gtaaaataa

DBGET integrated database retrieval system