KEGG   Bacillus thuringiensis Bt407: BTB_c00200Help
Entry
BTB_c00200        CDS       T02277                                 

Gene name
dck
Definition
deoxyadenosine/deoxycytidine kinase Dck (EC:2.7.1.74 2.7.1.76)
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btg00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BTB_c00200 (dck)
   00240 Pyrimidine metabolism
    BTB_c00200 (dck)
Enzymes [BR:btg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     BTB_c00200 (dck)
    2.7.1.76  2'-deoxyadenosine kinase
     BTB_c00200 (dck)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(22158..22826)
Genome map
AA seq 222 aa AA seqDB search
MNLRQKYDIPNDAVITIAGTVGVGKSTMTTALANALGYRTSFEKVDSNPYLDKFYADFTR
WSFHLQVYFLAERFKEQKRIFEYGGGFVQDRSIYEDTGIFAKMHHEKGTMTETDYETYKG
LFDAMVMTPYFPHPDLLIYLEGSFDDIVDRIQERGRPMEQQTPIEYWKEMHGRYENWINN
FNSCPVLRLNINEYDILKDGDSIEPIIKKIGHFLKQTRKLVK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaggcaaaaatatgatatacccaatgacgcagtaatcactatcgccggaacg
gtaggtgtgggtaaatcaactatgacaactgcattagctaatgctttaggttatcgcaca
tcatttgaaaaagtagattccaatccatacttggacaagttctatgcggacttcactcgc
tggagcttccacctacaagtgtactttttagcagaacgatttaaggaacaaaaaagaatt
tttgaatacggtggcggttttgttcaagatcgttctatttacgaagacactggaattttc
gcaaagatgcatcatgaaaaaggtacgatgacggaaactgattatgaaacatacaaaggg
ttatttgacgctatggtcatgactccttacttccctcatccagacttattaatttactta
gaaggttctttcgatgatattgtcgatcgtattcaagaacgcggacgcccaatggaacag
caaacgccaattgagtactggaaagaaatgcatggacgttatgaaaactggattaacaac
tttaattcatgccctgtattacgcttaaatattaatgagtacgatattttaaaagatggg
gattcaatcgaaccaatcattaaaaaaattggccattttttaaaacaaacacgtaaactt
gtaaaataa

DBGET integrated database retrieval system