KEGG   Bacillus thuringiensis Bt407: BTB_c00510Help
Entry
BTB_c00510        CDS       T02277                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase IspE
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg00900  Terpenoid backbone biosynthesis
btg01100  Metabolic pathways
btg01110  Biosynthesis of secondary metabolites
btg01130  Biosynthesis of antibiotics
Module
btg_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:btg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BTB_c00510 (ispE)
Enzymes [BR:btg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BTB_c00510 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C Peptidase_C42
Motif
Other DBs
NCBI-ProteinID: AFV15851
Position
47691..48569
Genome map
AA seq 292 aa AA seqDB search
MNRLKLLVKAPAKINLSLDVLGKRQDGYHEVKMIMTTIDLADRLELTELAEDRIEILSHN
RYVPDDQRNLAYQAAKLLKEKFNVKKGVSITIEKTIPVAAGLAGGSSDAAATLRGLNKLW
NLGLTIDELAELGAEIGSDVSFCVYGGTAIATGRGEKIEHIKTPPSCWVILAKPHIGVST
ADVYGNLKLNRVTHPNVDKMVDVINSGDYKGICDTVGNVLEDVTFGMHPEVARIKSQMKR
FGADAVLMSGSGPTVFGLVHHDSRMHRIYNGLKGFCEQVYAVRLLGERETLE
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgaatagattgaagctactagtgaaagcaccagcaaagattaatctgtcgttagatgta
ctgggaaaaagacaagacggatatcatgaagtgaaaatgattatgacaaccattgattta
gcagatcgtctagaactaacggaattagcagaagaccgtattgaaattttatcccataat
cggtatgtcccagacgaccaacgaaatttagcttatcaggcagcgaaattattaaaagag
aagtttaatgtaaaaaaaggtgtatctattactattgaaaaaacgattccagtagcagct
ggattagcaggtggaagtagtgatgcagcagcgacattacgtggtcttaataaattatgg
aatttagggcttacaattgatgagttagcagagcttggcgcagaaattggatcagatgta
tctttctgtgtatacggcggcacagcaattgccactggaagaggagagaaaattgagcat
ataaagactccgccttcttgttgggttattttagcgaaaccacatataggtgtatctact
gctgatgtgtatggaaatttaaagttaaatcgagttacacatccaaatgtagataaaatg
gttgatgtcataaattctggagattataaagggatttgtgatactgttggtaacgtttta
gaagatgtaacatttggaatgcatcctgaagttgcacgtattaaatcacagatgaagcga
ttcggagcggatgctgtattgatgagtggaagtggtccaactgtatttggacttgtacac
catgattctcgaatgcatcgcatttataacggattaaaaggattttgtgaacaggtctat
gcggtacgtttattaggagagcgagaaacgcttgaataa

DBGET integrated database retrieval system