KEGG   Bacillus thuringiensis Bt407: BTB_c00800Help
Entry
BTB_c00800        CDS       T02277                                 

Gene name
sul
Definition
dihydropteroate synthase Sul (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:btg00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
77088..77948
Genome map
AA seq 286 aa AA seqDB search
MNYEEEMCSLKWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKE
MQGEGAHIIDIGGESTRPGFAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQA
IEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIA
KNAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPV
EERLEGTGATVCLGIEKGCEFVRVHDVKEMARMAKMMDAMIGKGVR
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaattacgaagaggagatgtgtagtttgaagtgggattatgatttacgctgcggcgaa
tatacattgaatttaaatgaaaagacattaattatggggattttaaatgtaacaccagat
tcgttttctgatggtgggagttacaacgaggtagatgctgcggtacgtcacgcaaaagaa
atgcaaggtgaaggtgctcatattattgatattggtggcgaatctactcgcccaggtttt
gctaaagtatcagtagaagaagaaataaagcgagtcgtcccgatgattcaagcagtttca
aaagaagtaaaattacctatatctatcgatacatataaagctgaagttgcaaagcaagca
attgaggctggtgctcatattattaatgatatttggggggcgaaggcggagccgaaaatt
gctgaagtcgcagcccattatgatgtacccatcattttaatgcataaccgtgataatatg
aattatcgtaatttaatggcggatatgattgctgatttgtatgacagtattaaaattgct
aaaaatgctggtgtgcgagatgagaatattattttagatccaggtatcggttttgctaaa
acaccggagcagaacttagaggcgatgcgtaatttagaacagttaaatgtgctaggttat
ccggttctcttaggtacttcgagaaagtcctttattgggcacgtattagatttgccagta
gaggaacgccttgagggaacgggagctactgtttgtcttggtattgaaaagggctgtgag
tttgttcgtgtccatgatgtgaaagaaatggcgcgtatggctaaaatgatggatgcgatg
attggtaagggggtaaggtaa

DBGET integrated database retrieval system