KEGG   Bacillus thuringiensis Bt407: BTB_c00820Help
Entry
BTB_c00820        CDS       T02277                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase FolK (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:btg00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
78308..78823
Genome map
AA seq 171 aa AA seqDB search
MNNIAYIALGSNIGERYTYLTEAIQFLNKSPYIQVDDVSSVYETDPVGYTDQSCFLNLVI
KISTNLSPQELLKVTQKVENDLGRKREIRWGPRTIDLDILLYNQENIEAENLIVPHPRMF
ERAFVIVPLLEINQDIKQNISRSQVEEMKRREGVTVWKQKNGEDAFVLFES
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaataatatagcgtacattgcattagggtcaaatattggagagcgttatacgtattta
actgaagccattcagtttttaaataaaagtccgtatattcaagttgatgatgtttcgtca
gtgtatgaaactgatccagttggctatactgaccaaagttgttttttaaatttagttata
aaaatttctaccaatttatcaccgcaagaattattgaaagtaacacaaaaagtagaaaat
gacctaggaagaaaaagggaaattaggtgggggccgaggactatcgaccttgacatttta
ctttataatcaagagaatattgaagcagagaatcttattgttccgcatccgcggatgttc
gaaagagcttttgttatcgttccgttgttagagattaatcaagatataaaacaaaacatt
tcacgttcacaagtagaagaaatgaaaaggcgagagggagtaacggtatggaagcagaaa
aatggggaagacgcattcgtgcttttcgaaagctaa

DBGET integrated database retrieval system