KEGG   Bacillus thuringiensis Bt407: BTB_c01870Help
Entry
BTB_c01870        CDS       T02277                                 

Gene name
rocF
Definition
(GenBank) arginase RocF
  KO
K01476  arginase [EC:3.5.3.1]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg00220  Arginine biosynthesis
btg00330  Arginine and proline metabolism
btg01100  Metabolic pathways
btg01110  Biosynthesis of secondary metabolites
btg01130  Biosynthesis of antibiotics
btg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:btg00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BTB_c01870 (rocF)
   00330 Arginine and proline metabolism
    BTB_c01870 (rocF)
Enzymes [BR:btg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BTB_c01870 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AFV15958
Position
158043..158936
Genome map
AA seq 297 aa AA seqDB search
MKKEISVIGVPMDLGQMRRGVDMGPSAIRYAGVIERIEEIGYDVKDMGDICIEREKEIDE
NTKLRNLTQVATVCNELASKVDHIIEEGRFPLVLGGDHSIAIGTLAGVAKHYKNLGVIWY
DAHGDLNTEETSPSGNIHGMSLAASLGYGHSSLVDLYGAYPKVKKENVVIIGARALDEGE
KDFIRNEGIKVFSMHEIDRMGMTAVMEETIAYLSHTDGVHLSLDLDGLDPHDAPGVGTPV
IGGLSYRESHLAMEMLAEADIITSAEFVEVNTILDERNRTATTAVALMGSLFGEKLK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaaatctcagttattggagttccaatggatttagggcagatgcgtcgtggc
gttgatatgggaccgagcgcaatccgttatgcaggggtaattgaaagaattgaagaaatt
ggatatgacgttaaagatatgggagatatatgtatagagagagaaaaagagatagatgaa
aatacaaaattaagaaaccttacacaagttgcaactgtatgtaatgaattagcaagtaag
gtggatcatattatagaagaaggtcgttttccacttgtattaggtggtgaccatagtatt
gctatcggtacattagctggtgtagcaaaacattataaaaacttaggtgttatttggtat
gatgcacacggtgatttaaatacagaggaaacttcaccatctggaaatattcacggtatg
tcacttgcagcaagtttagggtatggacattcttcacttgtagatttatatggagcatat
ccaaaggtgaaaaaagagaatgtcgtaattatcggtgcgcgtgcattggatgaaggagaa
aaagatttcattcgcaatgaaggtattaaagtgttctcaatgcatgaaattgatcgtatg
gggatgacggctgttatggaagaaacaatcgcatatttatctcatactgatggtgtacac
ttatcattagatttagatggtcttgatcctcatgatgcaccaggtgttgggacgcctgta
attggtggtctatcttatcgtgaaagccacttggcgatggaaatgttagcagaagcggat
attatcacatctgctgaatttgttgaggtaaatacgattttagatgagagaaatagaacg
gcaacaacagcagttgctttaatgggttctttattcggtgaaaaactaaaataa

DBGET integrated database retrieval system