KEGG   Bacillus thuringiensis Bt407: BTB_c10920Help
Entry
BTB_c10920        CDS       T02277                                 

Gene name
glpK
Definition
glycerol kinase GlpK (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btg00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BTB_c10920 (glpK)
Enzymes [BR:btg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BTB_c10920 (glpK)
Exosome [BR:btg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BTB_c10920 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1060452..1061942
Genome map
AA seq 496 aa AA seqDB search
MKKYILSLDQGTTSSRAILFNKKGEIVHSAQKEFTQHFPKPGWVEHNAQEIWGSILAVIA
TCLSEADVKPEQIAGIGITNQRETTVVWDKTTSKPIYNAIVWQSRQTAEICDELKEKGYG
EMVREKTGLLIDAYFSGTKVKWILDNVEGAREKAENGDLLFGTIDSWLVWKLSGGKAHVT
DYSNASRTLMFNIHDLQWDDELLDMLTVPKSMLPEVRPSSEIYGETIDYHFFGQNVPIAG
VAGDQQAALFGQACFGEGMAKNTYGTGCFMLMNTGEKAVASEHGLLTTIAWGIDGKVNYA
LEGSIFVAGSAIQWLRDGMRMFKDASESEVYASRVESTDGVYVVPAFVGLGTPYWDSEVR
GAMFGVTRGTTKEHFIRATLESLAYQTKDVLCAMEADSGIELKTLRVDGGAVKNNFLMKF
QSDILDVPVERPVINETTALGAAYLAGLAVGYWKNQDEIKSQWHMDKRFEPTMEAETSEE
LYAGWKKAIEATKAFK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatatattctttcattagaccaaggaacaacaagctcacgtgcaattttattc
aataaaaaaggtgaaattgttcattcagctcaaaaagagtttacacaacattttccaaag
ccgggctgggtagagcataatgcgcaagaaatttggggatctattttagcagttatcgca
acttgcttaagcgaagcagatgtaaaaccagaacaaatcgctggtatcggtattacgaac
caacgtgaaacaacggttgtatgggataaaacaactagtaaaccaatttacaacgcaatc
gtatggcaatctcgccaaacagctgaaatttgtgatgagttaaaagaaaaaggttatggc
gaaatggttcgcgaaaaaacaggtcttttaattgacgcatacttctctggtacgaaagta
aaatggattttagataacgttgaaggtgcaagagagaaagcagaaaacggcgatctatta
ttcggaacaattgattcgtggcttgtatggaaactatctggtggtaaagcgcacgtaacg
gattactcaaatgcatcacgtacgttaatgtttaacattcacgacttacaatgggatgat
gagcttctagatatgttaacagtaccaaagagcatgcttccagaagtacgtccatcatct
gaaatatatggagaaacaattgactatcacttcttcggtcaaaatgtaccaattgcaggt
gtagctggtgaccaacaagcggcattatttggacaagcttgtttcggtgaaggtatggcg
aaaaatacttacggaactggttgcttcatgttaatgaacacaggtgaaaaagcagtagct
tctgagcacggtctattaacaacaattgcatggggaatagatggtaaagtgaactatgca
ttagaaggaagtattttcgtagcaggttctgcgattcagtggttacgtgacggaatgcgc
atgtttaaagatgcaagtgagagtgaagtatatgcctctcgcgttgaatcaactgacggt
gtatacgttgtaccagcattcgttggactaggaacaccttattgggatagtgaagtacgc
ggcgctatgtttggtgtaacacgcggtacgacgaaagagcatttcattcgtgcaacgcta
gaatctttagcttaccaaacgaaagatgtattatgcgcaatggaagcagattcaggtatt
gaactgaaaacattacgcgttgatggcggagcggttaaaaataacttcttaatgaagttc
caaagtgatattttagatgttcctgtagagcgtccagtgatcaacgaaacgacagcttta
ggtgcagcatacttagctggtcttgcggttggatattggaaaaaccaagatgaaattaaa
tcacagtggcatatggacaaacgctttgaaccaacgatggaagcggaaacaagcgaagag
ctatatgctggatggaaaaaagcaattgaagcaacaaaagctttcaaataa

DBGET integrated database retrieval system