KEGG   Bacillus thuringiensis Bt407: BTB_c11380Help
Entry
BTB_c11380        CDS       T02277                                 

Gene name
hemY1
Definition
protoporphyrinogen oxidase HemY (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:btg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BTB_c11380 (hemY1)
Enzymes [BR:btg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BTB_c11380 (hemY1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1106062..1107468
Genome map
AA seq 468 aa AA seqDB search
MIVGGGITGLTAMYNLQKNIHEKNLPIDTLLIEASGKLGGKIQTVRKDGFTIERGPDSFL
ARKESVARLVKELGLGDELVNNQAGQSFILVNNRLHKMPNGSMMGIPTQITPFLFSGLFS
PIGKLRAGFDLLMPRSKPVSDQSLGQFFRHRLGNEVVENLIEPLLSGIYAGDIDEMSLMS
TFPQMYQIEQKHRSISLGMRTLAPKEEKAEPKKGMFQTVKTGLESIVKSLEAKMHEGTII
KGTRIEKIAKQGDGYTITLSNGKEIEADAIVVATSHKVLPSMFAQYKQFRFFRNIPSTSV
ANVALAFPKSAIQRDINGTGFVVSRNSDYTITACTWTHKKWPHTTPEGKTLLRCYVGRAG
DEAVVEQTEEELVQLVLEDLRKTMDITEDPEFTIVSRWKEAMPQYTVGHNERMKKLTTFM
EKELPGIYLAGSSYAGAGLPDCINQGEEAAKRVLSHLEKVIDAELIAQ
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgtcggcggaggcatcactggattaacagcaatgtataacttacaaaaaaatatt
catgaaaaaaacttgccgattgatacattacttatagaagcatcgggtaaactaggcgga
aaaattcaaaccgttcgaaaagatggatttacaattgagcgcggaccggattctttctta
gcacgaaaagaaagtgtagctagattagtgaaagaattaggtctcggcgatgaacttgta
aataatcaagccggtcaatcatttatccttgtaaacaatcggttacataaaatgccgaat
ggatcaatgatgggaattccaacgcaaattacgccgtttctattttccgggctgttctcc
ccgattggtaaactaagagctggctttgatctattaatgccgaggtcaaagccagtatct
gaccaatcactcggacaattttttaggcatcgtcttggaaatgaagtggttgaaaactta
atagaaccgttactatcgggtatttatgcaggggatattgatgaaatgagcttaatgtca
acattcccgcaaatgtatcaaattgagcagaaacatcgcagtatttcactcggtatgcgt
acgctcgctccgaaagaagagaaagctgaaccgaaaaagggaatgttccaaacagtgaaa
acaggtttagaatctatcgtaaaatctctcgaagcaaagatgcatgaaggtacgataata
aagggaactcgcattgaaaaaattgcaaaacagggtgatggttatacgattactcttagt
aacggaaaagaaatagaagcggacgccatcgtagtggcaacttcgcataaagtattgccg
tccatgtttgctcagtacaagcagtttcgtttcttccgtaatattccatccacatccgtt
gccaatgtcgcacttgctttcccaaaatctgcaatccagcgcgatattaatggtacagga
tttgtcgtatcacgaaatagcgattacacgattacagcatgtacgtggacgcataaaaaa
tggccacatacaacgccagaaggaaaaacactccttcgctgttacgttggacgtgctggt
gatgaagctgttgtagaacaaactgaagaagaactcgttcagctcgtactagaagattta
cgaaagacgatggatattacagaggatccagagtttacaatcgtaagtcgctggaaagaa
gcgatgcctcaatatactgtaggccataacgagcgaatgaaaaagctcacaacatttatg
gagaaagagttgccaggtatatacttggcaggtagctcctatgctggtgctggacttcca
gattgtattaatcaaggtgaggaagctgcaaagcgtgtattatctcatttggagaaagta
atagatgctgaattaatcgcacaataa

DBGET integrated database retrieval system