KEGG   Bacillus thuringiensis Bt407: BTB_c11380Help
Entry
BTB_c11380        CDS       T02277                                 

Gene name
hemY1
Definition
protoporphyrinogen oxidase HemY (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:btg00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1106062..1107468
Genome map
AA seq 468 aa AA seqDB search
MIVGGGITGLTAMYNLQKNIHEKNLPIDTLLIEASGKLGGKIQTVRKDGFTIERGPDSFL
ARKESVARLVKELGLGDELVNNQAGQSFILVNNRLHKMPNGSMMGIPTQITPFLFSGLFS
PIGKLRAGFDLLMPRSKPVSDQSLGQFFRHRLGNEVVENLIEPLLSGIYAGDIDEMSLMS
TFPQMYQIEQKHRSISLGMRTLAPKEEKAEPKKGMFQTVKTGLESIVKSLEAKMHEGTII
KGTRIEKIAKQGDGYTITLSNGKEIEADAIVVATSHKVLPSMFAQYKQFRFFRNIPSTSV
ANVALAFPKSAIQRDINGTGFVVSRNSDYTITACTWTHKKWPHTTPEGKTLLRCYVGRAG
DEAVVEQTEEELVQLVLEDLRKTMDITEDPEFTIVSRWKEAMPQYTVGHNERMKKLTTFM
EKELPGIYLAGSSYAGAGLPDCINQGEEAAKRVLSHLEKVIDAELIAQ
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgtcggcggaggcatcactggattaacagcaatgtataacttacaaaaaaatatt
catgaaaaaaacttgccgattgatacattacttatagaagcatcgggtaaactaggcgga
aaaattcaaaccgttcgaaaagatggatttacaattgagcgcggaccggattctttctta
gcacgaaaagaaagtgtagctagattagtgaaagaattaggtctcggcgatgaacttgta
aataatcaagccggtcaatcatttatccttgtaaacaatcggttacataaaatgccgaat
ggatcaatgatgggaattccaacgcaaattacgccgtttctattttccgggctgttctcc
ccgattggtaaactaagagctggctttgatctattaatgccgaggtcaaagccagtatct
gaccaatcactcggacaattttttaggcatcgtcttggaaatgaagtggttgaaaactta
atagaaccgttactatcgggtatttatgcaggggatattgatgaaatgagcttaatgtca
acattcccgcaaatgtatcaaattgagcagaaacatcgcagtatttcactcggtatgcgt
acgctcgctccgaaagaagagaaagctgaaccgaaaaagggaatgttccaaacagtgaaa
acaggtttagaatctatcgtaaaatctctcgaagcaaagatgcatgaaggtacgataata
aagggaactcgcattgaaaaaattgcaaaacagggtgatggttatacgattactcttagt
aacggaaaagaaatagaagcggacgccatcgtagtggcaacttcgcataaagtattgccg
tccatgtttgctcagtacaagcagtttcgtttcttccgtaatattccatccacatccgtt
gccaatgtcgcacttgctttcccaaaatctgcaatccagcgcgatattaatggtacagga
tttgtcgtatcacgaaatagcgattacacgattacagcatgtacgtggacgcataaaaaa
tggccacatacaacgccagaaggaaaaacactccttcgctgttacgttggacgtgctggt
gatgaagctgttgtagaacaaactgaagaagaactcgttcagctcgtactagaagattta
cgaaagacgatggatattacagaggatccagagtttacaatcgtaagtcgctggaaagaa
gcgatgcctcaatatactgtaggccataacgagcgaatgaaaaagctcacaacatttatg
gagaaagagttgccaggtatatacttggcaggtagctcctatgctggtgctggacttcca
gattgtattaatcaaggtgaggaagctgcaaagcgtgtattatctcatttggagaaagta
atagatgctgaattaatcgcacaataa

DBGET integrated database retrieval system