KEGG   Bacillus thuringiensis Bt407: BTB_c11800Help
Entry
BTB_c11800        CDS       T02277                                 

Gene name
mls
Definition
(RefSeq) malate synthase Mls (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:btg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BTB_c11800 (mls)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BTB_c11800 (mls)
   00630 Glyoxylate and dicarboxylate metabolism
    BTB_c11800 (mls)
Enzymes [BR:btg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BTB_c11800 (mls)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
1149324..1150913
Genome map
AA seq 529 aa AA seqDB search
MSTQTSRVTLVGEMLPAYNEILTPEVLSFLKELHENFNERRIELLQKRVEKQKRIDAGEF
PKFLEETKHIREADWTIAKLPKDLEDRRVEITGPVDRKMVINALNSGAHLFMADFEDSNS
PTWENAVEGQINLRDAVKGTISHENDKGKEYRLNEKTAVLIVRPRGWHLEEKHMQVDGKN
MSGSLVDFGLYFFHNAKALLAKGSGPYFYLPKMESYLEARLWNDVFVFAQKYIGIPNGTI
KATVLLETIHASFEMDEILYELKDHSAGLNCGRWDYIFSFLKSFRNHNKFLLPDRAQVTM
TAPFMRSYSLKVIQTCHRRNAPAIGGMAAQIPIKNNPEANEAAFEKVRADKEREALDGHD
GTWVAHPGLVPVAMEVFNHIMKTPNQIFRKREEICVTENDLLDVPVGTITEEGLRMNISV
GIQYIASWLSGRGAAPIYNLMEDAATAEISRAQVWQWIRHEGGKLNDGRNITFELMEELK
EEELAKIEREIGKEAFKKGRFQEATTLFTNLVRNDEFVPFLTLPGYEIL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgcaaacttcacgggttacactcgttggagaaatgttaccagcgtacaacgaa
atattgacacctgaggtgcttagttttttgaaggaactacatgagaatttcaatgagcgc
cgcatagaacttttacaaaaacgtgtagaaaaacaaaagagaattgatgcaggggagttt
ccgaagtttctagaagaaacaaaacacatacgtgaagcggattggacaattgccaagctg
ccaaaagacttagaggatcgccgcgtagagattactggaccggtagatagaaagatggtc
attaacgctttaaattcaggagcgcatctttttatggcggattttgaagattcgaattca
ccaacttgggaaaatgcagttgaaggtcaaatcaacttacgagatgcagtaaagggaacg
atttcacatgaaaatgataaagggaaagaatatagattaaatgagaaaacagctgtactc
attgtacgtccaagaggatggcatttagaggaaaagcatatgcaagttgatgggaaaaat
atgtcgggtagcttagtagatttcggcttgtactttttccataatgcgaaagctctttta
gcaaaagggagcggtccatacttttacttaccgaaaatggaaagttatttagaagcgaga
ttatggaatgatgtattcgtatttgctcaaaaatatatcggcattccaaatggaacgatt
aaagcaactgtgttactggaaacgattcacgcttcgtttgaaatggatgaaattttgtat
gagctaaaagatcattctgctggcttaaactgcggaagatgggattatatttttagcttt
ttaaagagtttccgtaatcataataaattcttactaccagatagagcacaagtcacgatg
acggcgccatttatgcgttcgtattctttgaaagtaattcaaacatgtcaccgccgtaat
gcaccagcaattggaggaatggcggcacaaattccgattaaaaataatccagaagcaaat
gaagcagcttttgaaaaagtgcgtgctgataaggagcgcgaagctttagacggtcatgat
gggacttgggttgcccaccctggacttgtaccggttgcaatggaagtatttaatcacatt
atgaaaacaccgaatcaaatttttagaaaacgtgaagaaatatgtgtaacagaaaacgat
ttactagatgtaccagtgggaacgattacagaagagggccttcgcatgaatattagcgta
ggtattcaatatattgcatcttggttaagcggacggggagcagcacccatttataactta
atggaagatgcggcaactgctgaaatttcaagagcacaagtatggcaatggattcgtcat
gaaggtggaaaactaaatgatggtcgtaatattacgtttgaattaatggaagagctaaaa
gaagaagaattagcaaaaatagaaagagagattggtaaggaagcctttaagaaagggaga
ttccaagaggcgacaactttgtttacaaatctcgttcgaaatgatgaattcgtaccattt
ttaacattaccgggttatgaaattttataa

DBGET integrated database retrieval system