KEGG   Bacillus thuringiensis Bt407: BTB_c12880Help
Entry
BTB_c12880        CDS       T02277                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:btg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BTB_c12880 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BTB_c12880 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BTB_c12880 (trpB)
Enzymes [BR:btg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BTB_c12880 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
1252127..1253320
Genome map
AA seq 397 aa AA seqDB search
MNYAYPDEKGHYGIYGGRYVPETLMQSVLELEEAYKEAMQDEAFQKELNHYLKTYVGRET
PLYYAENMTKYCGGAKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGAGQHG
VATATVCALLGLECVIFMGEEDVRRQKLNVFRMELLGAKVESVAAGSGTLKDAVNEALRY
WVSHVHDTHYIMGSVLGPHPFPQIVRDFQSVIGNETKKQYEALEGKLPEAVVACIGGGSN
AMGMFYPFVHDEEVALYGVEAAGKGVHTEKHAATLTKGSVGVLHGSMMYLLQNEEGQIQE
AHSISAGLDYPGVGPEHSLLKDIGRVSYQSITDEEALEAFQLLTKKEGIIPALESSHAVA
YALKLAPQMKTDEGLVICLSGRGDKDVESIKRYMEEV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgcatatccagatgaaaaaggacattacggtatatacggaggacgatacgtt
ccagaaacgttaatgcaatctgtactagaactagaagaagcatataaagaagcgatgcaa
gatgaagcatttcaaaaggaattaaatcattatttaaaaacgtacgtcggaagagaaaca
ccgctatattatgctgaaaatatgacgaagtattgcggtggtgcaaagatttatttaaaa
cgtgaagatttgaatcatacaggagctcataaaattaacaatacaatcggtcaggcacta
cttgcagtgcgaatgggcaagaaaaaagttgtcgctgaaacaggagctggacaacacgga
gttgcaacagctactgtatgtgctcttctcggattagaatgcgtcatttttatgggagaa
gaagatgtaagacgtcaaaaattaaatgtgttccgaatggaattactcggagcgaaagta
gaaagtgtagcggcaggtagcggtacattaaaagatgcggtaaacgaggcgcttcgttac
tgggtttcacatgtgcatgatacgcactacattatgggatctgttctcggaccacatcca
ttcccgcaaattgtccgtgatttccaaagtgtaattggaaatgaaacgaaaaaacaatat
gaggcgttagaaggaaagttaccagaagcagtcgttgcttgtattggcggtggtagtaat
gcgatggggatgttttatccgttcgtacacgatgaagaagttgctctttacggcgtagaa
gcagctggaaaaggcgttcatacagaaaagcatgcagcaactttaacgaaaggaagcgtc
ggtgttttacacggatcaatgatgtatcttctgcaaaatgaagaagggcaaattcaagaa
gcacactctatttcagcaggacttgattatccaggtgttggtccagaacatagtttgcta
aaagatattggccgcgtttcttatcagtcgataacagacgaagaagcattagaagcattt
caattattaacgaaaaaagaaggcattatcccggcgttagaaagttcacatgctgtcgca
tacgcattaaaattagcgccgcaaatgaagacagacgaagggcttgtcatttgtttatca
ggccgcggggataaagatgtagagagtataaaacgttatatggaagaggtgtaa

DBGET integrated database retrieval system