KEGG   Bacillus thuringiensis Bt407: BTB_c12890Help
Entry
BTB_c12890        CDS       T02277                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:btg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BTB_c12890 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BTB_c12890 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BTB_c12890 (trpA)
Enzymes [BR:btg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BTB_c12890 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1253324..1254100
Genome map
AA seq 258 aa AA seqDB search
MGVEKIKAAFENGKKAFIPYVMGGDGGFEKLKERIRFLDEAGASIVEIGIPFSDPVADGP
TIQRAGKRALDSGVTVKGIFQALIEVRKEVQLPFVLMTYLNPVLAFGKERFVENCLEAGV
DGIIVPDLPYEEQNIIAPLLREANIALIPLVTVTSPIERIEKITSESEGFVYAVTVAGVT
GVRQNFKEEIHSYLEKVKSHVNLPVVAGFGISTKEHVEEMVTICDGVVVGSKIIELLETE
KREEICELIYATKQKEEA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgggagtagaaaaaattaaagcagcgtttgaaaatggtaagaaagcatttattccgtac
gtaatgggcggagatggtggctttgaaaaattaaaagaaagaattcgttttttagatgaa
gcaggagcgagcatcgttgaaatcggcattccgttttcggatccagttgcagacggtcca
acgattcaaagagcagggaaacgagcgctagatagcggtgtaacagtaaaaggtattttt
caagcattaatagaggtaaggaaagaagtgcaacttccgtttgtactcatgacatattta
aatccagtacttgcattcggaaaagaacgatttgtagagaactgcttagaggccggtgtg
gatggtattatcgttccagacttaccgtatgaagaacaaaatattattgcgccgttactt
cgagaggcaaacattgcgctcattccactcgttaccgtaacgagtcctattgaaagaatt
gaaaaaattacgagtgaatcagaagggttcgtttatgctgttacagtagcgggcgtaacg
ggagtacgtcaaaactttaaagaggagattcatagttacttagaaaaagtaaaatcacac
gtcaacttaccagtagtcgctggattcggcatttcaacaaaagaacatgtagaagaaatg
gttacaatatgcgacggagttgtcgttggaagtaagatcattgagcttttagaaactgaa
aagcgagaagaaatatgtgaattaatatatgcaacaaaacaaaaagaagaggcgtag

DBGET integrated database retrieval system