KEGG   Bacillus thuringiensis Bt407: BTB_c12890Help
Entry
BTB_c12890        CDS       T02277                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg00260  Glycine, serine and threonine metabolism
btg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
btg01100  Metabolic pathways
btg01110  Biosynthesis of secondary metabolites
btg01130  Biosynthesis of antibiotics
btg01230  Biosynthesis of amino acids
Module
btg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:btg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BTB_c12890 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BTB_c12890 (trpA)
Enzymes [BR:btg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BTB_c12890 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth BtpA PcrB NMO
Motif
Other DBs
NCBI-ProteinID: AFV16984
Position
1253324..1254100
Genome map
AA seq 258 aa AA seqDB search
MGVEKIKAAFENGKKAFIPYVMGGDGGFEKLKERIRFLDEAGASIVEIGIPFSDPVADGP
TIQRAGKRALDSGVTVKGIFQALIEVRKEVQLPFVLMTYLNPVLAFGKERFVENCLEAGV
DGIIVPDLPYEEQNIIAPLLREANIALIPLVTVTSPIERIEKITSESEGFVYAVTVAGVT
GVRQNFKEEIHSYLEKVKSHVNLPVVAGFGISTKEHVEEMVTICDGVVVGSKIIELLETE
KREEICELIYATKQKEEA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgggagtagaaaaaattaaagcagcgtttgaaaatggtaagaaagcatttattccgtac
gtaatgggcggagatggtggctttgaaaaattaaaagaaagaattcgttttttagatgaa
gcaggagcgagcatcgttgaaatcggcattccgttttcggatccagttgcagacggtcca
acgattcaaagagcagggaaacgagcgctagatagcggtgtaacagtaaaaggtattttt
caagcattaatagaggtaaggaaagaagtgcaacttccgtttgtactcatgacatattta
aatccagtacttgcattcggaaaagaacgatttgtagagaactgcttagaggccggtgtg
gatggtattatcgttccagacttaccgtatgaagaacaaaatattattgcgccgttactt
cgagaggcaaacattgcgctcattccactcgttaccgtaacgagtcctattgaaagaatt
gaaaaaattacgagtgaatcagaagggttcgtttatgctgttacagtagcgggcgtaacg
ggagtacgtcaaaactttaaagaggagattcatagttacttagaaaaagtaaaatcacac
gtcaacttaccagtagtcgctggattcggcatttcaacaaaagaacatgtagaagaaatg
gttacaatatgcgacggagttgtcgttggaagtaagatcattgagcttttagaaactgaa
aagcgagaagaaatatgtgaattaatatatgcaacaaaacaaaaagaagaggcgtag

DBGET integrated database retrieval system