KEGG   Bacillus thuringiensis Bt407: BTB_c13050Help
Entry
BTB_c13050        CDS       T02277                                 

Gene name
odhB
Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg00020  Citrate cycle (TCA cycle)
btg00310  Lysine degradation
btg01100  Metabolic pathways
btg01110  Biosynthesis of secondary metabolites
btg01120  Microbial metabolism in diverse environments
btg01130  Biosynthesis of antibiotics
btg01200  Carbon metabolism
Module
btg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
btg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:btg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BTB_c13050 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    BTB_c13050 (odhB)
Enzymes [BR:btg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BTB_c13050 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AFV17000
Position
complement(1269553..1270812)
Genome map
AA seq 419 aa AA seqDB search
MIEIKVPELAESITEGTISQWLINVGDKVEKGGSVVELETDKVNVEIIAEDSGIVSKLLG
EPGDTVEVGATIAILDANGAPVAVSTPAPAAEQPKQETAEAPKAAAPNAEQTTGLQGLPN
TNRPIASPAARKMARELGIDLNDVRSTDPLGRVRPHDVQAHAAAPKEAPAAPKSPAPAPV
AKTEFEKPVERVKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMSAIMELRKERKDAFEKK
HDVRLGFMSFFTKAVVAALKQFPLLNAEIQGDELIIKKFYDIGIAVAAPDGLVVPVVRDA
NQLNFAEIESEIRNLGMKARDNKLSLKELQGGTFTITNGGVFGSLMSTPILNSPQVGILG
MHKIQVRPVAIDAERMENRPMMYLALSYDHRIVDGKEAVSFLVAVKDMLEDPKSLLLEG
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaattaaagtacctgagcttgcagaatctattaccgaaggaactatttcacaa
tggcttatcaacgtaggcgacaaagttgagaaaggtggcagcgttgttgagcttgaaact
gataaagtcaatgtagaaatcattgcagaagattcaggtattgtatcgaagttactaggc
gaacctggggatacagttgaagttggcgcaactatcgcaattttagatgctaatggagca
ccagttgcagtaagtacacctgctccagctgctgagcaaccaaaacaagaaacagctgaa
gcaccgaaagctgcagctccaaatgctgaacaaactacgggtctacaaggcttaccaaat
acgaaccgtcctattgcatcaccagctgctagaaaaatggctcgtgaattaggaatcgac
ttaaacgacgtacgtagcacagatccacttggacgcgtgagaccacatgatgtacaagct
catgctgcagcaccaaaagaagcaccagctgctccaaagagtccagctcctgctccagtt
gcaaaaactgaattcgaaaaaccagttgagcgtgtgaaaatgtcccgccgccgtcaaaca
attgcaaaacgtcttgtagaagttcaacaaacatctgcaatgttaacaacatttaacgaa
gttgatatgagtgcgatcatggaattacgtaaagaacgcaaagatgctttcgagaaaaaa
catgatgtacgtcttggcttcatgtcattcttcacaaaagcagttgttgcagcattaaaa
caattcccattattaaatgctgaaattcaaggtgacgagcttatcatcaaaaaattctat
gatatcggtattgcagtagcagctccagatggattagttgttccagttgtacgcgatgct
aaccaattaaacttcgctgaaatcgaaagtgaaattcgtaatttaggtatgaaagcacgc
gataacaaactttcattaaaagaactacaaggtggtacatttacaattacaaacggtggt
gtattcggttctctaatgtcaacaccaatcctaaatagcccacaagtaggtattttagga
atgcataaaattcaagtacgcccagttgcaattgatgcagaacgtatggaaaaccgtccg
atgatgtaccttgcactatcttacgatcaccgtattgttgatggtaaagaagcagttagc
ttccttgttgctgttaaagatatgcttgaagatccaaaatcattattattagaaggttga

DBGET integrated database retrieval system