KEGG   Bacillus thuringiensis Bt407: BTB_c20360Help
Entry
BTB_c20360        CDS       T02277                                 

Gene name
thrC
Definition
threonine synthase ThrC (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:btg01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:btg00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:btg00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1952726..1953784
Genome map
AA seq 352 aa AA seqDB search
MYKGLLKQYASYLPVNENTPDVSLMEGNTPLIPLLNISKQLGIQLYGKYEGANPTGSFKD
RGMVMAVAKAKEEGSEAIICASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVA
YGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIEGQKTAAFEICDQLQNAPDVL
AIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIEEPETIATAIRI
GNPASWSYAVEAAEQSCGEIDMVSDEEILHAYRLLAKTEGVFAEPGSNASLAGVIKHVKS
GKIKKGETVVAVLTGNGLKDPDIAISSNQLDIASLSNDIEQIKDHIKGVIMS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggactattgaaacaatatgcttcttatttaccggtgaatgaaaacacacct
gatgtcagtttaatggaaggaaacacacctcttattccgttattaaatatatcaaagcaa
ttagggattcagctatatggtaagtacgaaggagcgaatccgacaggttcttttaaagat
cgtggtatggtgatggcagttgctaaggcgaaagaagaaggttcagaagcaatcatttgt
gcatcaacaggtaatacatcagcatcagctgcagcatatgcggcacgtcttgggatgaaa
tgtataatcgtaatccctgaaggaaagattgcgcatggaaaattagcgcaagcggtcgct
tatggagctgaaattatttcaatagaagggaatttcgatgatgcacttaaggctgtaaga
aatattgctgcagaagagccgattacattagtaaattcagtgaatccttatcgaattgaa
ggacaaaaaacagcagcatttgaaatttgtgatcaattgcaaaatgcaccagatgttcta
gctatccctgttgggaacgcagggaatattacagcatattggaaaggcttctgtgaatat
gagaaagaaaaaggttataagaagccaagaattcatggctttgaagcagaaggagcagcg
gcaattgtaaaagggcatgtaattgaagagcctgaaacaattgcaacagcaattcgcatt
ggtaacccagcaagttggtcgtatgcagtagaggctgccgagcagtcttgtggtgaaata
gatatggtatcagatgaagaaattttacatgcgtataggttattggcaaaaactgaagga
gttttcgctgaaccgggatcaaatgcttcattagctggcgtaattaaacatgttaaatct
ggaaaaatcaaaaagggagaaacagttgttgcagtattaactggaaatggtttgaaggat
cctgatatcgctatttcttcaaatcaactagacatcgcaagtttgtcaaatgatatagaa
cagattaaagatcatattaaaggggtgattatgtcgtga

DBGET integrated database retrieval system