KEGG   Bacillus thuringiensis Bt407: BTB_c21960Help
Entry
BTB_c21960        CDS       T02277                                 

Gene name
nasF
Definition
(GenBank) uroporphyrinogen-III C-methyltransferase NasF
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg00860  Porphyrin and chlorophyll metabolism
btg01100  Metabolic pathways
btg01110  Biosynthesis of secondary metabolites
btg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BTB_c21960 (nasF)
Enzymes [BR:btg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     BTB_c21960 (nasF)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BTB_c21960 (nasF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase HEM4
Motif
Other DBs
NCBI-ProteinID: AFV17888
Position
complement(2098474..2099898)
Genome map
AA seq 474 aa AA seqDB search
MNGYVYLVGAGPGDEGLITKKAIECLNRADIVLYDRLLNPSFLNYTKETCELIYCGKMPK
NHTMRQEMINSHLLQFAKEGKIVVRLKGGDPSIFGRVGEEAETLASANIPYEIVPGITSS
IAASIYAGIPLTHRDYSNSVTLLTGHAKGPLSDHGKYNSSYNSDTIAYYMGIKNLPTICE
NLLQAGKKEDTPVAVIEWGTTGKQRVVTGTLSTIVSIVKNENISNPSMTIVGDVVSLRNQ
ISWKERKPLHSKKVLFASATNKKSAIKQMLQESGAEIYQIPTFKKKEYTLTSEQINKIFN
VDRLVFCSADSVDILMQSCSKYHKDIRSLQAELQYMNLSIQEKLMQYGLFSKPAQFSSNS
TIYLGRNINRIAVIQEKIGAGSYMMTHEYTIDHRFDEIHSRILSEFSWDSIVFEGRASID
TFLAEIKRLGFINILTLPFSYTDVPTLHYANKVGFHNVDHQLQETLMKKDMVRQ
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaacggatatgtatatttagttggtgcaggaccaggtgatgaagggcttattacaaaa
aaagcgatagagtgcttaaatcgtgcagatatcgtcttatatgaccgcttattaaaccct
tcctttcttaattatacaaaagaaacatgtgaacttatttattgcggaaaaatgccaaag
aatcatactatgcgtcaagaaatgattaactcacacctccttcaatttgcgaaagaagga
aaaatcgtagtccgcttaaaaggcggagatccatctatttttggccgtgttggtgaagaa
gcagaaactttagcatcagcaaatattccatatgaaattgtaccaggtattacatctagc
atcgccgctagtatctatgcaggtattcccctcacccaccgtgactacagtaatagtgtc
actttattaaccggacatgcaaaaggtcctttaagtgatcatggaaaatataattcatct
tacaatagcgacacgattgcctactacatgggtataaaaaacttacctacaatttgtgaa
aacttactacaagcaggaaaaaaagaagatacgccagtagcagtcattgaatggggtaca
actggtaaacagcgcgttgtcacagggacactgtctaccattgtttctattgtcaaaaac
gaaaatatttctaatccttctatgacaattgttggtgatgtcgtttccttacgtaatcaa
atctcttggaaagaacgcaagccattgcacagcaagaaagttttatttgcatctgcaaca
aataaaaaaagcgcaataaagcaaatgttacaagagtccggtgcagaaatatatcaaatt
ccaactttcaaaaagaaagaatacacattaacctctgaacaaatcaataagatttttaac
gttgatcgtcttgtattttgttccgctgacagtgtagacatcttaatgcaatcatgcagt
aaatatcataaagatattcgttccttacaggcagaacttcagtatatgaacctttctatt
caagaaaagctcatgcaatatggattgttcagtaaacctgcgcaattttcttcgaattca
acgatttatttaggacgaaacattaaccgaattgctgttattcaagaaaaaattggtgct
ggttcctatatgatgactcatgagtacacaattgatcatcgcttcgatgaaattcattca
cgtattctttctgaattctcatgggatagcattgtatttgaaggtcgtgcttctattgat
acgtttctagcagaaataaaacgccttggctttatcaatattcttactctcccattctcg
tataccgacgttccaactttacactatgcaaataaagttgggtttcataacgtagatcat
caattacaagaaactcttatgaagaaagacatggtgagacaatga

DBGET integrated database retrieval system